MCP-2/CCL8 Protein, Mouse, Recombinant

Name: MCP-2/CCL8 Protein, Mouse, Recombinant
Brand: TargetMol
SKU: TMPH-04235
Rating: 4.5 (1 reviews)

(Synonyms: Small-inducible cytokine A8, Scya8, Monocyte chemotactic protein 2 (MCP-2), Monocyte chemoattractant protein 2, Mcp2, Ccl8, C-C motif chemokine 8) Copy Product Info

Synonyms: Small-inducible cytokine A8, Scya8, Monocyte chemotactic protein 2 (MCP-2), Monocyte chemoattractant protein 2, Mcp2, Ccl8, C-C motif chemokine 8

Catalog No. TMPH-04235 Copy Product Info

CCL8 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is Q9Z121.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$147	7-10 days	7-10 days
10 µg	$223	7-10 days	7-10 days
20 µg	$382	7-10 days	7-10 days
50 µg	$739	7-10 days	7-10 days
100 µg	$1,220	7-10 days	7-10 days
200 µg	$1,720	7-10 days	7-10 days
500 µg	$2,730	7-10 days	7-10 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 10-100 ng/ml.
Description	CCL8 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is Q9Z121.
Species	Mouse
Expression System	E. coli
Tag	Tag Free
Accession Number	Q9Z121
Amino Acid	GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
Construction	24-97 aa
Protein Purity	>97% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Small-inducible cytokine A8, Scya8, Monocyte chemotactic protein 2 (MCP-2), Monocyte chemoattractant protein 2, Mcp2, Ccl8, C-C motif chemokine 8

Chemical Properties

Molecular Weight

8.5 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.