CCL6 Protein, Mouse, Recombinant

Name: CCL6 Protein, Mouse, Recombinant
Brand: TargetMol
SKU: TMPH-04233
Rating: 4.5 (1 reviews)

(Synonyms: Small-inducible cytokine A6, Scya6, Protein C10, Ccl6, C-C motif chemokine 6, C10) Copy Product Info

Synonyms: Small-inducible cytokine A6, Scya6, Protein C10, Ccl6, C-C motif chemokine 6, C10

Catalog No. TMPH-04233 Copy Product Info

CCL6 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P27784.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$223	7-10 days	7-10 days
10 µg	$368	7-10 days	7-10 days
20 µg	$529	7-10 days	7-10 days
50 µg	$848	7-10 days	7-10 days
100 µg	$1,220	7-10 days	7-10 days
200 µg	$1,720	7-10 days	7-10 days
500 µg	$2,730	7-10 days	7-10 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human CCR1 transfected murine BaF3 cells is in a concentration range of 10-100 ng/ml.
Description	CCL6 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P27784.
Species	Mouse
Expression System	E. coli
Tag	Tag Free
Accession Number	P27784
Amino Acid	GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA
Construction	22-116 aa
Protein Purity	>97% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 µm filtered concentrated solution in 20 mM Tris, pH 8.0, 500 mM NaCl.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Small-inducible cytokine A6, Scya6, Protein C10, Ccl6, C-C motif chemokine 6, C10

Chemical Properties

Molecular Weight

10.7 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.