CCL5 Protein, Mouse, Recombinant

Catalog No. TMPH-04232

CCL5 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P30882.

CCL5 Protein, Mouse, Recombinant

Catalog No. TMPH-04232

CCL5 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P30882.

Pack Size	Price	Availability
5 μg	$147	In Stock
10 μg	$223	7-10 days
20 μg	$382	7-10 days
50 μg	$739	7-10 days
100 μg	$1,220	7-10 days
200 μg	$1,720	7-10 days
500 μg	$2,730	7-10 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T lymphocytes is in a concentration range of 1.0-10 ng/ml.
Description	CCL5 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P30882.
Species	Mouse
Expression System	E. coli
Tag	Tag Free
Accession Number	P30882
Synonyms	T-cell-specific protein RANTES,Small-inducible cytokine A5,SIS-delta,Scya5,MuRantes,Ccl5,C-C motif chemokine 5
Amino Acid	SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
Construction	24-91 aa
Protein Purity	>97% as determined by SDS-PAGE.
Molecular Weight	7.9 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.