Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CCL5 Protein, Mouse, Recombinant

Catalog No. TMPH-04232 Copy Product Info
CCL5 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P30882.

CCL5 Protein, Mouse, Recombinant

Catalog No. TMPH-04232
Copy Product Info

CCL5 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P30882.

CCL5 Protein, Mouse, Recombinant
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$147-In Stock
10 μg$2237-10 days7-10 days
20 μg$3827-10 days7-10 days
50 μg$7397-10 days7-10 days
100 μg$1,2207-10 days7-10 days
200 μg$1,7207-10 days7-10 days
500 μg$2,7307-10 days7-10 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T lymphocytes is in a concentration range of 1.0-10 ng/ml.
Description
CCL5 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P30882.
Species
Mouse
Expression System
E. coli
TagTag Free
Accession NumberP30882
Synonyms
T-cell-specific protein RANTES,Small-inducible cytokine A5,SIS-delta,Scya5,MuRantes,Ccl5,C-C motif chemokine 5
Amino Acid
SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
Construction
24-91 aa
Protein Purity
>97% as determined by SDS-PAGE.
CCL5 Protein, Mouse, Recombinant
Molecular Weight7.9 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords