CCL20 Protein, Mouse, Recombinant (Active)

Name: CCL20 Protein, Mouse, Recombinant (Active)
Brand: TargetMol
SKU: TMPH-04223
Rating: 4.5 (1 reviews)

(Synonyms: Small-inducible cytokine A20, Scya20, Macrophage inflammatory protein 3 alpha (MIP-3-alpha), Liver and activation-regulated chemokine, Larc, Ccl20, C-C motif chemokine 20, CC chemokine ST38, CC chemokine LARC, Beta-chemokine exodus-1) Copy Product Info

Synonyms: Small-inducible cytokine A20, Scya20, Macrophage inflammatory protein 3 alpha (MIP-3-alpha), Liver and activation-regulated chemokine, Larc, Ccl20, C-C motif chemokine 20, CC chemokine ST38, CC chemokine LARC, Beta-chemokine exodus-1

Catalog No. TMPH-04223 Copy Product Info

Purity: 97.53%

CCL20 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is O89093.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$147	7-10 days	7-10 days
10 µg	$246	7-10 days	7-10 days
20 µg	$416	-	In Stock
50 µg	$853	7-10 days	7-10 days
100 µg	$1,460	7-10 days	7-10 days
200 µg	$1,980	7-10 days	7-10 days
500 µg	$3,300	7-10 days	7-10 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:97.53%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human CCR6 transfected murine BaF3 cells is in a concentration range of 0.1-10 ng/ml.
Description	CCL20 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is O89093.
Species	Mouse
Expression System	E. coli
Tag	Tag Free
Accession Number	O89093
Amino Acid	ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM
Construction	28-97 aa
Protein Purity	>96% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Small-inducible cytokine A20, Scya20, Macrophage inflammatory protein 3 alpha (MIP-3-alpha), Liver and activation-regulated chemokine, Larc, Ccl20, C-C motif chemokine 20, CC chemokine ST38, CC chemokine LARC, Beta-chemokine exodus-1

Chemical Properties

Molecular Weight

8.0 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.