Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human CCR6 transfected murine BaF3 cells is in a concentration range of 0.1-10 ng/ml.

CCL20 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is O89093.

Mouse

E. coli

Small-inducible cytokine A20,Scya20,Macrophage inflammatory protein 3 alpha (MIP-3-alpha),Liver and activation-regulated chemokine,Larc,Ccl20,C-C motif chemokine 20,CC chemokine ST38,CC chemokine LARC,Beta-chemokine exodus-1

ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

28-97 aa

>96% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.