CCL14 Protein, Human, Recombinant

Catalog No. TMPH-03839

CCL14 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q16627.

CCL14 Protein, Human, Recombinant

Catalog No. TMPH-03839

CCL14 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q16627.

Pack Size	Price	Availability
5 μg	$223	7-10 days
10 μg	$368	7-10 days
20 μg	$529	7-10 days
50 μg	$848	7-10 days
100 μg	$1,220	7-10 days
200 μg	$1,720	7-10 days
500 μg	$2,730	7-10 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration of 5.0-20 ng/ml.
Description	CCL14 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q16627.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	Q16627
Synonyms	Small-inducible cytokine A14,SCYA14,NCC-2,NCC2,HCC-1(1-74),Chemokine CC-1/CC-3 (HCC-1/HCC-3),CCL14,C-C motif chemokine 14
Amino Acid	TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Construction	22-93 aa
Protein Purity	>96% as determined by SDS-PAGE.
Molecular Weight	8.4 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.