Shopping Cart
Remove All
Your shopping cart is currently empty
CB2/CNR2 Protein, Mouse, Recombinant (His)
Catalog No. TMPH-04216
CB2/CNR2 Protein, Mouse, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is P47936.
CB2/CNR2 Protein, Mouse, Recombinant (His)
Catalog No. TMPH-04216
CB2/CNR2 Protein, Mouse, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is P47936.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $519 | 20 days | 20 days | |
| 10 μg | $875 | 20 days | 20 days | |
| 20 μg | $1,480 | 20 days | 20 days | |
| 50 μg | $1,980 | 20 days | 20 days | |
| 100 μg | $2,480 | 20 days | 20 days |
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | CB2/CNR2 Protein, Mouse, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is P47936. |
| Species | Mouse |
| Expression System | in vitro E. coli expression system |
| Tag | N-10xHis |
| Accession Number | P47936 |
| Synonyms | mCB2,Cnr2,CB-2,CB2,Cannabinoid receptor 2 |
| Amino Acid | MEGCRETEVTNGSNGGLEFNPMKEYMILSSGQQIAVAVLCTLMGLLSALENMAVLYIILSSRRLRRKPSYLFISSLAGADFLASVIFACNFVIFHVFHGVDSNAIFLLKIGSVTMTFTASVGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALCVMWVLSALISYLPLMGWTCCPSPCSELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHRHVATLAEHQDRQVPGIARMRLDVRLAKTLGLVLAVLLICWFPALALMGHSLVTTLSDQVKEAFAFCSMLCLVNSMVNPIIYALRSGEIRSAAQHCLIGWKKYLQGLGPEGKEEGPRSSVTETEADVKTT |
| Construction | 1-347 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 41.0 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.