Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: hCB2, CX5, CNR2, CB2B, CB2A, CB-2, CB2, Cannabinoid receptor 2


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $529 | Inquiry | Inquiry | |
| 10 µg | $892 | Inquiry | Inquiry | |
| 20 µg | $1,510 | - | In Stock | |
| 50 µg | $1,980 | Inquiry | Inquiry | |
| 100 µg | $2,520 | Inquiry | Inquiry |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | CB2/CNR2 Protein, Human, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is P34972. |
| Species | Human |
| Expression System | in vitro E.coli expression system |
| Tag | N-10xHis |
| Accession Number | P34972 |
| Amino Acid | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC |
| Construction | 1-360 aa |
| Protein Purity | >85% as determined by SDS-PAGE. ![]() |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS,0.05% Brij-78,6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | hCB2, CX5, CNR2, CB2B, CB2A, CB-2, CB2, Cannabinoid receptor 2 |
| Molecular Weight | 42.5 kDa (Predicted); 42 kDa (Reducing condition) |
| Relative Density. | no data available |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.