CB2/CNR2 Protein, Human, Recombinant (His)

Name: CB2/CNR2 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04364
Rating: 4.5 (1 reviews)

(Synonyms: hCB2, CX5, CNR2, CB2B, CB2A, CB-2, CB2, Cannabinoid receptor 2) Copy Product Info

Synonyms: hCB2, CX5, CNR2, CB2B, CB2A, CB-2, CB2, Cannabinoid receptor 2

Catalog No. TMPH-04364 Copy Product Info

CB2/CNR2 Protein, Human, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is P34972.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$529	Inquiry	Inquiry
10 µg	$892	Inquiry	Inquiry
20 µg	$1,510	-	In Stock
50 µg	$1,980	Inquiry	Inquiry
100 µg	$2,520	Inquiry	Inquiry

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90%

Appearance:Lyophilized powder

Color:White

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	CB2/CNR2 Protein, Human, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is P34972.
Species	Human
Expression System	in vitro E.coli expression system
Tag	N-10xHis
Accession Number	P34972
Amino Acid	MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Construction	1-360 aa
Protein Purity	>85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS,0.05% Brij-78,6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	hCB2, CX5, CNR2, CB2B, CB2A, CB-2, CB2, Cannabinoid receptor 2

Chemical Properties

Molecular Weight	42.5 kDa (Predicted); 42 kDa (Reducing condition)
Relative Density.	no data available

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.