CB2/CNR2 Protein, Human, Recombinant (His)

Catalog No. TMPH-04364 Copy Product Info

CB2/CNR2 Protein, Human, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is P34972.

CB2/CNR2 Protein, Human, Recombinant (His)

Catalog No. TMPH-04364

Copy Product Info

CB2/CNR2 Protein, Human, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is P34972.

Pack Size	Price	USA Stock	Global Stock
5 μg	$529	Inquiry	Inquiry
10 μg	$892	Inquiry	Inquiry
20 μg	$1,510	-	In Stock
50 μg	$1,980	Inquiry	Inquiry
100 μg	$2,520	Inquiry	Inquiry

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	CB2/CNR2 Protein, Human, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is P34972.
Species	Human
Expression System	in vitro E.coli expression system
Tag	N-10xHis
Accession Number	P34972
Synonyms	hCB2,CX5,CNR2,CB2B,CB2A,CB-2,CB2,Cannabinoid receptor 2
Amino Acid	MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Construction	1-360 aa
Protein Purity	>85% as determined by SDS-PAGE.
Molecular Weight	42.5 kDa (Predicted); 42 kDa (Reducing condition)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS,0.05% Brij-78,6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.