Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CB2/CNR2 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04364

CB2/CNR2 Protein, Human, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is P34972.

CB2/CNR2 Protein, Human, Recombinant (His)

CB2/CNR2 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04364
CB2/CNR2 Protein, Human, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is P34972.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$529InquiryInquiry
10 μg$892InquiryInquiry
20 μg$1,510-In Stock
50 μg$1,980InquiryInquiry
100 μg$2,520InquiryInquiry
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
CB2/CNR2 Protein, Human, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is P34972.
Species
Human
Expression System
in vitro E.coli expression system
TagN-10xHis
Accession NumberP34972
Synonyms
hCB2,CX5,CNR2,CB2B,CB2A,CB-2,CB2,Cannabinoid receptor 2
Amino Acid
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Construction
1-360 aa
Protein Purity
>85% as determined by SDS-PAGE.
CB2/CNR2 Protein, Human, Recombinant (His)
Molecular Weight42.5 kDa (Predicted); 42 kDa (Reducing condition)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered PBS,0.05% Brij-78,6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords