Caspase-1 Protein, Human, Recombinant (HA)

Name: Caspase-1 Protein, Human, Recombinant (HA)
Brand: TargetMol
SKU: TMPH-01055
Price: 123 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: p45, Interleukin-1 beta-converting enzyme (ICE;IL-1 beta-converting enzyme), Interleukin-1 beta convertase (IL-1BC), IL1BCE, IL1BC, Caspase-1, CASP-1, CASP1) Copy Product Info

Synonyms: p45, Interleukin-1 beta-converting enzyme (ICE;IL-1 beta-converting enzyme), Interleukin-1 beta convertase (IL-1BC), IL1BCE, IL1BC, Caspase-1, CASP-1, CASP1

Catalog No. TMPH-01055 Copy Product Info

Caspase-1 Protein, Human, Recombinant (HA) is expressed in E. coli expression system with C-HA tag. The predicted molecular weight is 11.4 kDa and the accession number is P29466.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$123	-	In Stock
10 µg	$197	20 days	20 days
20 µg	$336	-	In Stock
50 µg	$493	20 days	20 days
100 µg	$690	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:92%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Caspase-1 Protein, Human, Recombinant (HA) is expressed in E. coli expression system with C-HA tag. The predicted molecular weight is 11.4 kDa and the accession number is P29466.
Species	Human
Expression System	E. coli
Tag	C-HA
Accession Number	P29466
Amino Acid	MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSA
Construction	1-91 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	p45, Interleukin-1 beta-converting enzyme (ICE;IL-1 beta-converting enzyme), Interleukin-1 beta convertase (IL-1BC), IL1BCE, IL1BC, Caspase-1, CASP-1, CASP1
Research Background	Thiol protease involved in a variety of inflammatory processes by proteolytically cleaving other proteins, such as the precursors of the inflammatory cytokines interleukin-1 beta (IL1B) and interleukin 18 (IL18) as well as the pyroptosis inducer Gasdermin-D (GSDMD), into active mature peptides. Plays a key role in cell immunity as an inflammatory response initiator: once activated through formation of an inflammasome complex, it initiates a proinflammatory response through the cleavage of the two inflammatory cytokines IL1B and IL18, releasing the mature cytokines which are involved in a variety of inflammatory processes. Cleaves a tetrapeptide after an Asp residue at position P1. Also initiates pyroptosis, a programmed lytic cell death pathway, through cleavage of GSDMD. In contrast to cleavage of interleukins IL1B and IL1B, recognition and cleavage of GSDMD is not strictly dependent on the consensus cleavage site but depends on an exosite interface on CASP1 that recognizes and binds the Gasdermin-D, C-terminal (GSDMD-CT) part. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive. In apoptotic cells, cleaves SPHK2 which is released from cells and remains enzymatically active extracellularly.; Apoptosis inactive.; Apoptosis inactive.

Chemical Properties

Molecular Weight

11.4 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.