Shopping Cart
Remove All
Your shopping cart is currently empty
CPQ may play an important role in the hydrolysis of circulating peptides. Catalyzes the hydrolysis of dipeptides with unsubstituted terminals into amino acids. May play a role in the liberation of thyroxine hormone from its thyroglobulin (Tg) precursor.
Carboxypeptidase Q Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 49.72 kDa and the accession number is Q9Y646.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | CPQ may play an important role in the hydrolysis of circulating peptides. Catalyzes the hydrolysis of dipeptides with unsubstituted terminals into amino acids. May play a role in the liberation of thyroxine hormone from its thyroglobulin (Tg) precursor._x000D_
Carboxypeptidase Q Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 49.72 kDa and the accession number is Q9Y646. |
| Species | Human |
| Expression System | HEK297 Cells |
| Tag | N-His |
| Accession Number | Q9Y646 |
| Synonyms | PGCP,LCH1 |
| Amino Acid | KAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKYPEQVVLVSGHLDSWDVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLHKVNISNYSLVMESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGASLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPRS |
| Construction | A DNA sequence encoding the human CPQ (21Lys - 472Ser) was expressed with a polyhistidine tag at the N-terminus. |
| Protein Purity | > 90 % as determined by SDS-PAGE. |
| Molecular Weight | 49.72 kDa (Predicted) |
| Endotoxin | < 1.0 EU per μg protein as determined by the LAL method. |
| Formulation | Supplied as sterile solution in PBS, pH 7.4. |
| Stability & Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Shipping | Shipping with dry-ice |
| Research Background | CPQ may play an important role in the hydrolysis of circulating peptides. Catalyzes the hydrolysis of dipeptides with unsubstituted terminals into amino acids. May play a role in the liberation of thyroxine hormone from its thyroglobulin (Tg) precursor. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.