Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Carboxypeptidase Q Protein, Human, Recombinant (His)

Catalog No. TMPZ-00005

CPQ may play an important role in the hydrolysis of circulating peptides. Catalyzes the hydrolysis of dipeptides with unsubstituted terminals into amino acids. May play a role in the liberation of thyroxine hormone from its thyroglobulin (Tg) precursor.
Carboxypeptidase Q Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 49.72 kDa and the accession number is Q9Y646.

Carboxypeptidase Q Protein, Human, Recombinant (His)

Carboxypeptidase Q Protein, Human, Recombinant (His)

Catalog No. TMPZ-00005
CPQ may play an important role in the hydrolysis of circulating peptides. Catalyzes the hydrolysis of dipeptides with unsubstituted terminals into amino acids. May play a role in the liberation of thyroxine hormone from its thyroglobulin (Tg) precursor.<br/>Carboxypeptidase Q Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 49.72 kDa and the accession number is Q9Y646.
Pack SizePriceAvailabilityQuantity
Bulk & Custom
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
CPQ may play an important role in the hydrolysis of circulating peptides. Catalyzes the hydrolysis of dipeptides with unsubstituted terminals into amino acids. May play a role in the liberation of thyroxine hormone from its thyroglobulin (Tg) precursor._x000D_ Carboxypeptidase Q Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 49.72 kDa and the accession number is Q9Y646.
Species
Human
Expression System
HEK297 Cells
TagN-His
Accession NumberQ9Y646
Synonyms
PGCP,LCH1
Amino Acid
KAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKYPEQVVLVSGHLDSWDVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLHKVNISNYSLVMESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGASLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPRS
Construction
A DNA sequence encoding the human CPQ (21Lys - 472Ser) was expressed with a polyhistidine tag at the N-terminus.
Protein Purity
> 90 % as determined by SDS-PAGE.
Molecular Weight49.72 kDa (Predicted)
Endotoxin< 1.0 EU per μg protein as determined by the LAL method.
FormulationSupplied as sterile solution in PBS, pH 7.4.
Stability & Storage
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
ShippingShipping with dry-ice
Research Background
CPQ may play an important role in the hydrolysis of circulating peptides. Catalyzes the hydrolysis of dipeptides with unsubstituted terminals into amino acids. May play a role in the liberation of thyroxine hormone from its thyroglobulin (Tg) precursor.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords