CAN1 Protein, S. cerevisiae, Recombinant (His)

Name: CAN1 Protein, S. cerevisiae, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04406
Rating: 4.5 (1 reviews)

(Synonyms: Canavanine resistance protein 1, CAN1, Arginine permease CAN1) Copy Product Info

Synonyms: Canavanine resistance protein 1, CAN1, Arginine permease CAN1

Catalog No. TMPH-04406 Copy Product Info

CAN1 Protein, S. cerevisiae, Recombinant (His) is expressed in E. coli. The accession number is P04817.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$143	20 days	20 days
10 µg	$235	20 days	20 days
20 µg	$393	20 days	20 days
50 µg	$568	20 days	20 days
100 µg	$756	20 days	20 days
200 µg	$1,080	20 days	20 days
500 µg	$1,760	20 days	20 days
1 mg	$2,550	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	CAN1 Protein, S. cerevisiae, Recombinant (His) is expressed in E. coli. The accession number is P04817.
Species	Saccharomyces cerevisiae
Expression System	E. coli
Tag	C-6xHis
Accession Number	P04817
Amino Acid	MTNSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDTFSMEDGIGDEDEGEVQNAEVKRELKQRH
Construction	1-92 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Canavanine resistance protein 1, CAN1, Arginine permease CAN1

Chemical Properties

Molecular Weight

17.6 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 43 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.