CAMK2N1 Protein, Human, Recombinant (His & Trx)

Catalog No. TMPH-01026

Potent and specific inhibitor of CaM-kinase II (CAMK2). CAMK2N1 Protein, Human, Recombinant (His & Trx) is expressed in E. coli expression system with N-6xHis-Trx tag. The predicted molecular weight is 25.6 kDa and the accession number is Q7Z7J9.

CAMK2N1 Protein, Human, Recombinant (His & Trx)

Catalog No. TMPH-01026

Pack Size	Price	Availability
5 μg	$89	20 days
10 μg	$143	20 days
20 μg	$237	20 days
50 μg	$358	20 days
100 μg	$490	20 days
200 μg	$755	20 days
500 μg	$1,330	20 days
1 mg	$2,080	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Potent and specific inhibitor of CaM-kinase II (CAMK2). CAMK2N1 Protein, Human, Recombinant (His & Trx) is expressed in E. coli expression system with N-6xHis-Trx tag. The predicted molecular weight is 25.6 kDa and the accession number is Q7Z7J9.
Species	Human
Expression System	E. coli
Tag	N-6xHis-Trx
Accession Number	Q7Z7J9
Synonyms	CaMKII inhibitory protein alpha (CaMKIIN-alpha),CAMK2N1,Calcium/calmodulin-dependent protein kinase II inhibitor 1
Amino Acid	MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV
Construction	1-78 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	25.6 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Potent and specific inhibitor of CaM-kinase II (CAMK2).