Potent and specific inhibitor of CaM-kinase II (CAMK2).
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 237.00 | |
100 μg | 20 days | $ 446.00 | |
1 mg | 20 days | $ 1,920.00 |
Description | Potent and specific inhibitor of CaM-kinase II (CAMK2). |
Species | Human |
Expression System | E. coli |
Tag | N-terminal 6xHis-Trx-tagged |
Accession Number | Q7Z7J9 |
Synonyms | Calcium/calmodulin-dependent protein kinase II inhibitor 1, CaMKII inhibitory protein alpha, CaMKIIN-alpha, CAMK2N1 |
Amino Acid | MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 1-78 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 25.6 kDa (predicted) |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Potent and specific inhibitor of CaM-kinase II (CAMK2). |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
CAMK2N1 Protein, Human, Recombinant (His & Trx) Calcium/calmodulin-dependent protein kinase II inhibitor 1 CaMKII inhibitory protein alpha CaMKIIN-alpha CAMK2N1 recombinant recombinant-proteins proteins protein