CACNA2D1 Protein, Human, Recombinant (His & SUMO)

Name: CACNA2D1 Protein, Human, Recombinant (His & SUMO)
Brand: TargetMol
SKU: TMPH-02308
Rating: 4.5 (1 reviews)

(Synonyms: Voltage-gated calcium channel subunit alpha-2/delta-1, Voltage-dependent calcium channel subunit alpha-2/delta-1, MHS3, CCHL2A, CACNL2A, CACNA2D1) Copy Product Info

Synonyms: Voltage-gated calcium channel subunit alpha-2/delta-1, Voltage-dependent calcium channel subunit alpha-2/delta-1, MHS3, CCHL2A, CACNL2A, CACNA2D1

Catalog No. TMPH-02308 Copy Product Info

The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling.

CACNA2D1 Protein, Human, Recombinant (His & SUMO)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$75	20 days	20 days
10 μg	$119	20 days	20 days
20 μg	$198	20 days	20 days
50 μg	$297	20 days	20 days
100 μg	$427	20 days	20 days
200 μg	$658	20 days	20 days
500 μg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling.
Species	Human
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	P54289
Amino Acid	QPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCN
Construction	528-668 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Voltage-gated calcium channel subunit alpha-2/delta-1, Voltage-dependent calcium channel subunit alpha-2/delta-1, MHS3, CCHL2A, CACNL2A, CACNA2D1
Research Background

Chemical Properties

Molecular Weight

32.3 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Related Tags: CACNA2D1 Protein, Human, Recombinant (His & SUMO) chemical structure | CACNA2D1 Protein, Human, Recombinant (His & SUMO) molecular weight