Shopping Cart
Remove All
Your shopping cart is currently empty
Bunyavirus La Crosse Nucleoprotein/NP Protein (His)
(Synonyms: Nucleoprotein, Nucleocapsid protein (Protein N)) Copy Product InfoSynonyms: Nucleoprotein, Nucleocapsid protein (Protein N)
Catalog No. TMPH-00316 Copy Product Info
Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation. Bunyavirus La Crosse Nucleoprotein/NP Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.5 kDa and the accession number is P04873.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $143 | 20 days | 20 days | |
| 10 μg | $238 | 20 days | 20 days | |
| 20 μg | $397 | 20 days | 20 days | |
| 50 μg | $597 | 20 days | 20 days | |
| 100 μg | $845 | 20 days | 20 days | |
| 200 μg | $1,190 | 20 days | 20 days | |
| 500 μg | $1,950 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation. Bunyavirus La Crosse Nucleoprotein/NP Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.5 kDa and the accession number is P04873. |
| Species | Bunyavirus La Crosse |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis |
| Accession Number | P04873 |
| Amino Acid | MSDLVFYDVASTGANGFDPDAGYMDFCVKNAESLNLAAVRIFFLNAAKAKAALSRKPERKANPKFGEWQVEVINNHFPGNRNNPIGNNDLTIHRLSGYLARWVLDQYNENDDESQHELIRTTIINPIAESNGVGWDSGPEIYLSFFPGTEMFLETFKFYPLTIGIHRVKQGMMDPQYLKKALRQRYGTLTADKWMSQKVAAIAKSLKDVEQLKWGKGGLSDTAKTFLQKFGIRLP |
| Construction | 1-235 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | Nucleoprotein, Nucleocapsid protein (Protein N) |
| Research Background |
| Molecular Weight | 28.5 kDa (predicted) |
| Storage | Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: Bunyavirus La Crosse Nucleoprotein/NP Protein (His) chemical structure | Bunyavirus La Crosse Nucleoprotein/NP Protein (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.