Shopping Cart
- Remove All
 Your shopping cart is currently empty Your shopping cart is currently empty
Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation. Bunyavirus La Crosse Nucleoprotein/NP Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.5 kDa and the accession number is P04873.

| Pack Size | Price | Availability | Quantity | 
|---|---|---|---|
| 5 μg | $143 | 20 days | |
| 10 μg | $238 | 20 days | |
| 20 μg | $397 | 20 days | |
| 50 μg | $597 | 20 days | |
| 100 μg | $845 | 20 days | |
| 200 μg | $1,190 | 20 days | |
| 500 μg | $1,950 | 20 days | 
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. | 
| Description | Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation. Bunyavirus La Crosse Nucleoprotein/NP Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.5 kDa and the accession number is P04873. | 
| Species | Bunyavirus La Crosse | 
| Expression System | P. pastoris (Yeast) | 
| Tag | N-6xHis | 
| Accession Number | P04873 | 
| Synonyms | Nucleoprotein,Nucleocapsid protein (Protein N) | 
| Amino Acid | MSDLVFYDVASTGANGFDPDAGYMDFCVKNAESLNLAAVRIFFLNAAKAKAALSRKPERKANPKFGEWQVEVINNHFPGNRNNPIGNNDLTIHRLSGYLARWVLDQYNENDDESQHELIRTTIINPIAESNGVGWDSGPEIYLSFFPGTEMFLETFKFYPLTIGIHRVKQGMMDPQYLKKALRQRYGTLTADKWMSQKVAAIAKSLKDVEQLKWGKGGLSDTAKTFLQKFGIRLP | 
| Construction | 1-235 aa | 
| Protein Purity | > 90% as determined by SDS-PAGE. | 
| Molecular Weight | 28.5 kDa (predicted) | 
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. | 
| Formulation | Tris-based buffer, 50% glycerol | 
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. | 
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. | 
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. | 
| Research Background | Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation. | 

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.