BTNL2 Protein, Human, Recombinant (Isoform 1, hFc)

Catalog No. TMPH-03821

BTNL2 Protein, Human, Recombinant (hFc) is expressed in HEK293 Cells with C-hFc. The accession number is Q9UIR0-1.

BTNL2 Protein, Human, Recombinant (Isoform 1, hFc)

Catalog No. TMPH-03821

BTNL2 Protein, Human, Recombinant (hFc) is expressed in HEK293 Cells with C-hFc. The accession number is Q9UIR0-1.

Pack Size	Price	Availability
5 μg	$75	20 days
10 μg	$119	20 days
20 μg	$198	20 days
50 μg	$333	20 days
100 μg	$497	20 days
200 μg	$791	20 days
500 μg	$1,530	20 days
1 mg	$2,520	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	BTNL2 Protein, Human, Recombinant (hFc) is expressed in HEK293 Cells with C-hFc. The accession number is Q9UIR0-1.
Species	Human
Expression System	HEK293 Cells
Tag	C-hFc
Accession Number	Q9UIR0-1
Synonyms	Butyrophilin-like protein 2,BTNL2,BTL-II
Amino Acid	KQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLKVAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSGW
Construction	24-455 aa
Protein Purity	>90% as determined by SDS-PAGE.
Molecular Weight	74.1 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.