Home Tools
Log in
Cart

Biglycan Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02548
Synonyms: PG-S1, Bone/cartilage proteoglycan I, Bgn, Biglycan

May be involved in collagen fiber assembly. Biglycan Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 43.4 kDa and the accession number is P28653.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Biglycan Protein, Mouse, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 284.00
100 μg 20 days $ 537.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description May be involved in collagen fiber assembly. Biglycan Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 43.4 kDa and the accession number is P28653.
Species Mouse
Expression System E. coli
Tag N-10xHis
Accession Number P28653
Synonyms PG-S1, Bone/cartilage proteoglycan I, Bgn, Biglycan
Amino Acid DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
Construction 38-369 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 43.4 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background May be involved in collagen fiber assembly.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Biglycan Protein, Mouse, Recombinant (His) PG-S1 Bone/cartilage proteoglycan I Bgn Biglycan recombinant recombinant-proteins proteins protein

 

TargetMol