Home Tools
Log in
Cart

Beta Defensin 1/DEFB1 Protein, Mouse, Recombinant (His & SUMO)

Catalog No. TMPH-02541
Synonyms: Beta-defensin 1, BD-1, mBD-1, Defensin, beta 1, Defb1

Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Beta Defensin 1/DEFB1 Protein, Mouse, Recombinant (His & SUMO)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.
Species Mouse
Expression System E. coli
Tag N-terminal 6xHis-SUMO-tagged
Accession Number P56386
Synonyms Beta-defensin 1, BD-1, mBD-1, Defensin, beta 1, Defb1
Amino Acid DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 33-69 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 20.1 kDa as predicted
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Beta Defensin 1/DEFB1 Protein, Mouse, Recombinant (His & SUMO) Beta-defensin 1 BD-1 mBD-1 Defensin, beta 1 Defb1 recombinant recombinant-proteins proteins protein

 

TargetMol