BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc)

Catalog No. TMPH-04740 Copy Product Info

BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q9VLU0.

Catalog No. TMPH-04740

Copy Product Info

BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q9VLU0.

Pack Size	Price	USA Stock	Global Stock
5 μg	$143	20 days	20 days
10 μg	$238	20 days	20 days
20 μg	$397	20 days	20 days
50 μg	$726	20 days	20 days
100 μg	$1,150	20 days	20 days
200 μg	$1,770	20 days	20 days
500 μg	$3,130	20 days	20 days
1 mg	$4,830	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q9VLU0.
Species	Fruit fly
Expression System	HEK293 Cells
Tag	N-hFc
Accession Number	Q9VLU0
Synonyms	Barrier-to-autointegration factor,baf
Amino Acid	MSGTSQKHRNFVAEPMGNKSVTELAGIGETLGGRLKDAGFDMAYTVLGQYLVLKKDEELFKDWMKEVCHASSKQASDCYNCLNDWCEEFL
Construction	1-90 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	38.4 kDa (Predicted)
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 377 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

You can also refer to dose conversion for different animals. More

Please read the User Guide of Recombinant Proteins for more specific information.