BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc)

Name: BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc)
Brand: TargetMol
SKU: TMPH-04740
Rating: 4.5 (1 reviews)

(Synonyms: Barrier-to-autointegration factor, baf) Copy Product Info

Synonyms: Barrier-to-autointegration factor, baf

Catalog No. TMPH-04740 Copy Product Info

BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q9VLU0.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$143	20 days	20 days
10 μg	$238	20 days	20 days
20 μg	$397	20 days	20 days
50 μg	$726	20 days	20 days
100 μg	$1,150	20 days	20 days
200 μg	$1,770	20 days	20 days
500 μg	$3,130	20 days	20 days
1 mg	$4,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q9VLU0.
Species	Fruit fly
Expression System	HEK293 Cells
Tag	N-hFc
Accession Number	Q9VLU0
Amino Acid	MSGTSQKHRNFVAEPMGNKSVTELAGIGETLGGRLKDAGFDMAYTVLGQYLVLKKDEELFKDWMKEVCHASSKQASDCYNCLNDWCEEFL
Construction	1-90 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 377 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Barrier-to-autointegration factor, baf

Chemical Properties

Molecular Weight

38.4 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Related Tags: BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc) chemical structure | BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc) molecular weight