Shopping Cart
- Remove All
- Your shopping cart is currently empty
BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q9VLU0.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $143 | 20 days | |
10 μg | $238 | 20 days | |
20 μg | $397 | 20 days | |
50 μg | $726 | 20 days | |
100 μg | $1,150 | 20 days | |
200 μg | $1,770 | 20 days | |
500 μg | $3,130 | 20 days | |
1 mg | $4,830 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q9VLU0. |
Species | Fruit fly |
Expression System | HEK293 Cells |
Tag | N-hFc |
Accession Number | Q9VLU0 |
Synonyms | Barrier-to-autointegration factor,baf |
Amino Acid | MSGTSQKHRNFVAEPMGNKSVTELAGIGETLGGRLKDAGFDMAYTVLGQYLVLKKDEELFKDWMKEVCHASSKQASDCYNCLNDWCEEFL |
Construction | 1-90 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 38.4 kDa (Predicted) |
Endotoxin | Not tested. |
Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 377 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.