Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc)

TargetMol | SPR
Catalog No. TMPH-04740

BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q9VLU0.

BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc)

BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc)

TargetMol | SPR
Catalog No. TMPH-04740
BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q9VLU0.
Pack SizePriceAvailabilityQuantity
5 μg$14320 days
10 μg$23820 days
20 μg$39720 days
50 μg$72620 days
100 μg$1,15020 days
200 μg$1,77020 days
500 μg$3,13020 days
1 mg$4,83020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
BAF Protein, Drosophila melanogaster (Fruit fly), Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q9VLU0.
Species
Fruit fly
Expression System
HEK293 Cells
TagN-hFc
Accession NumberQ9VLU0
Synonyms
Barrier-to-autointegration factor,baf
Amino Acid
MSGTSQKHRNFVAEPMGNKSVTELAGIGETLGGRLKDAGFDMAYTVLGQYLVLKKDEELFKDWMKEVCHASSKQASDCYNCLNDWCEEFL
Construction
1-90 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight38.4 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 377 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.