Shopping Cart
Remove All
Your shopping cart is currently empty
ATP6V0D1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P61421.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $87 | 20 days | 20 days | |
| 10 μg | $139 | 20 days | 20 days | |
| 20 μg | $232 | 20 days | 20 days | |
| 50 μg | $329 | 20 days | 20 days | |
| 100 μg | $435 | 20 days | 20 days | |
| 200 μg | $673 | 20 days | 20 days | |
| 500 μg | $1,180 | 20 days | 20 days | |
| 1 mg | $1,870 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | ATP6V0D1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P61421. |
| Species | Human |
| Expression System | E. coli |
| Tag | C-10xHis |
| Accession Number | P61421 |
| Synonyms | V-type proton ATPase subunit d 1,VPATPD,V-ATPase subunit d 1,V-ATPase AC39 subunit (p39),V-ATPase 40 kDa accessory protein,Vacuolar proton pump subunit d 1,ATP6V0D1,ATP6D,32 kDa accessory protein |
| Amino Acid | MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF |
| Construction | 1-351 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 50.1 kDa (Predicted) |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 177 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.