Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Astrotactin-1/ASTN1 Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04701

Astrotactin-1/ASTN1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is O14525.

Astrotactin-1/ASTN1 Protein, Human, Recombinant (His)

Astrotactin-1/ASTN1 Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04701
Astrotactin-1/ASTN1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is O14525.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$11620 days20 days
10 μg$18920 days20 days
20 μg$31720 days20 days
50 μg$44820 days20 days
100 μg$58820 days20 days
200 μg$91320 days20 days
500 μg$1,63020 days20 days
1 mg$2,55020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Astrotactin-1/ASTN1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is O14525.
Species
Human
Expression System
E. coli
TagC-6xHis
Accession NumberO14525
Synonyms
KIAA0289,Astrotactin-1,ASTN1,ASTN
Amino Acid
TAAGDVDPSKELECKLKSITVSALPFLRENDLSIMHSPSASEPKLLFSVRNDFPGEMVVVDDLENTELPYFVLEISGNTEDIPLVRWRQQWLENGTLLFHIHHQDGAPSLPGQDPTEEPQHESAEEELRILH
Construction
22-153 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight21.8 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 338 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords