ASFV (strain Ba71V) p17 Protein (His)

Name: ASFV (strain Ba71V) p17 Protein (His)
Brand: TargetMol
SKU: TMPH-00032
Rating: 4.5 (1 reviews)

(Synonyms: Minor capsid protein p17) Copy Product Info

Synonyms: Minor capsid protein p17

Catalog No. TMPH-00032 Copy Product Info

Essential for the correct processing of both structural polyproteins and for the maturation of viral precursor membranes at the viral factories. ASFV (strain Ba71V) p17 Protein (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 19.2 kDa and the accession number is Q89424.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$526	20 days	20 days
10 µg	$886	20 days	20 days
20 µg	$1,500	20 days	20 days
50 µg	$2,090	20 days	20 days
100 µg	$2,750	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Essential for the correct processing of both structural polyproteins and for the maturation of viral precursor membranes at the viral factories. ASFV (strain Ba71V) p17 Protein (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 19.2 kDa and the accession number is Q89424.
Species	ASFV
Expression System	E. coli
Tag	N-10xHis
Accession Number	Q89424
Amino Acid	MDTETSPLLSHNLSTREGIKQSTQGLLAHTIARYPGTTAILLGILILLVIILIIVAIVYYNRSVDCKSSMPKPPPSYYVQQPEPHHHFPVFFRKRKNSTSLQSHIPSDEQLAELAHS
Construction	1-117 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Minor capsid protein p17
Research Background	Essential for the correct processing of both structural polyproteins and for the maturation of viral precursor membranes at the viral factories.

Chemical Properties

Molecular Weight

19.2 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.