Virus attachment protein.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 1,550.00 | |
100 μg | 20 days | $ 2,800.00 |
Description | Virus attachment protein. |
Species | ASFV |
Expression System | in vitro E. coli expression system |
Tag | N-terminal 10xHis-tagged |
Accession Number | P0C9Y3 |
Synonyms | Protein p12, Pret-110, Inner membrane protein p12 |
Amino Acid | MALDGSSGGGSNVETLLIVAIIVVIMAIMLYYFWWMPRQQKKCSKAEECTCNNGSCSLKTS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 1-61 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 12.7 kDa (predicted) |
Formulation | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Virus attachment protein. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
ASFV (isolate Tick/South Africa/Pretoriuskop Pr4/1996) p12 Protein (His) Protein p12 Pret-110 Inner membrane protein p12 recombinant recombinant-proteins proteins protein