Home Tools
Log in
Cart

ASFV (isolate Tick/South Africa/Pretoriuskop Pr4/1996) p12 Protein (His)

Catalog No. TMPH-00034
Synonyms: Protein p12, Pret-110, Inner membrane protein p12

Virus attachment protein.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
ASFV (isolate Tick/South Africa/Pretoriuskop Pr4/1996) p12 Protein (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 1,550.00
100 μg 20 days $ 2,800.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Virus attachment protein.
Species ASFV
Expression System in vitro E. coli expression system
Tag N-terminal 10xHis-tagged
Accession Number P0C9Y3
Synonyms Protein p12, Pret-110, Inner membrane protein p12
Amino Acid MALDGSSGGGSNVETLLIVAIIVVIMAIMLYYFWWMPRQQKKCSKAEECTCNNGSCSLKTS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 1-61 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 12.7 kDa (predicted)
Formulation Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Virus attachment protein.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

ASFV (isolate Tick/South Africa/Pretoriuskop Pr4/1996) p12 Protein (His) Protein p12 Pret-110 Inner membrane protein p12 recombinant recombinant-proteins proteins protein

 

TargetMol