Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: APRT, Adenine phosphoribosyltransferase


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $87 | 20 days | 20 days | |
| 10 µg | $139 | 20 days | 20 days | |
| 20 µg | $232 | 20 days | 20 days | |
| 50 µg | $329 | 20 days | 20 days | |
| 100 µg | $435 | 20 days | 20 days | |
| 200 µg | $673 | 20 days | 20 days | |
| 500 µg | $1,180 | 20 days | 20 days | |
| 1 mg | $1,870 | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | APRT Protein, Human, Recombinant (GST) is expressed in E. coli. The accession number is P07741. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-GST |
| Accession Number | P07741 |
| Amino Acid | MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE |
| Construction | 1-180 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | APRT, Adenine phosphoribosyltransferase |
| Molecular Weight | 46.5 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 345 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.