Home Tools
Log in
Cart

APOC1 Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02515
Synonyms: Apolipoprotein C-I, Apo-CI, APOC1, ApoC-I, Apolipoprotein C1

APOC1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 12.5 kDa and the accession number is P34928.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
APOC1 Protein, Mouse, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 780.00
100 μg 20 days $ 1,150.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description APOC1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 12.5 kDa and the accession number is P34928.
Species Mouse
Expression System E. coli
Tag N-10xHis
Accession Number P34928
Synonyms Apolipoprotein C-I, Apo-CI, APOC1, ApoC-I, Apolipoprotein C1
Amino Acid APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS
Construction 27-88 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 12.5 kDa (predicted)
Formulation Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein. Binds free fatty acids and reduces their intracellular esterification.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

APOC1 Protein, Mouse, Recombinant (His) Apolipoprotein C-I Apo-CI APOC1 ApoC-I Apolipoprotein C1 recombinant recombinant-proteins proteins protein

 

TargetMol