Home Tools
Log in
Cart

ANXA5 Protein, Human, Recombinant (His)

Catalog No. TMPH-00938
Synonyms: ANXA5, Annexin A5, Annexin V, Calphobindin I (CPB-I), ENX2, Endonexin II, PP4, Annexin-5, Anchorin CII

This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. ANXA5 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 37.8 kDa and the accession number is P08758.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
ANXA5 Protein, Human, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 341.00
100 μg 20 days $ 646.00
500 μg 20 days $ 1,780.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. ANXA5 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 37.8 kDa and the accession number is P08758.
Species Human
Expression System P. pastoris (Yeast)
Tag N-6xHis
Accession Number P08758
Synonyms ANXA5, Annexin A5, Annexin V, Calphobindin I (CPB-I), ENX2, Endonexin II, PP4, Annexin-5, Anchorin CII
Amino Acid AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Construction 2-320 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 37.8 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

ANXA5 Protein, Human, Recombinant (His) ANXA5 Annexin A5 Annexin V Calphobindin I (CPB-I) ENX2 Endonexin II PP4 Annexin-5 Anchorin CII recombinant recombinant-proteins proteins protein

 

TargetMol