This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. ANXA5 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 37.8 kDa and the accession number is P08758.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 341.00 | |
100 μg | 20 days | $ 646.00 | |
500 μg | 20 days | $ 1,780.00 |
Description | This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. ANXA5 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 37.8 kDa and the accession number is P08758. |
Species | Human |
Expression System | P. pastoris (Yeast) |
Tag | N-6xHis |
Accession Number | P08758 |
Synonyms | ANXA5, Annexin A5, Annexin V, Calphobindin I (CPB-I), ENX2, Endonexin II, PP4, Annexin-5, Anchorin CII |
Amino Acid | AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD |
Construction | 2-320 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 37.8 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
ANXA5 Protein, Human, Recombinant (His) ANXA5 Annexin A5 Annexin V Calphobindin I (CPB-I) ENX2 Endonexin II PP4 Annexin-5 Anchorin CII recombinant recombinant-proteins proteins protein