Antifungal Protein, Aspergillus giganteus, Recombinant (B2M & His) is expressed in E. coli.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | Antifungal Protein, Aspergillus giganteus, Recombinant (B2M & His) is expressed in E. coli. |
Species | Aspergillus giganteus |
Expression System | E. coli |
Tag | N-terminal 6xHis-B2M-tagged |
Accession Number | P17737 |
Synonyms | afp, Antifungal protein |
Amino Acid | ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 44-94 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 19.8 kDa as predicted |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | This protein inhibits the growth of a variety of fungal species. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
Antifungal Protein, Aspergillus giganteus, Recombinant (B2M & His) afp Antifungal protein recombinant recombinant-proteins proteins protein