Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.

Anoctamin-1/ANO1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli. The accession number is Q5XXA6.

Human

E. coli

Tumor-amplified and overexpressed sequence 2,Transmembrane protein 16A,TMEM16A,TAOS2,ORAOV2,Oral cancer overexpressed protein 2,DOG1,Discovered on gastrointestinal stromal tumors protein 1,Anoctamin-1,ANO1

SFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLA

806-892 aa

> 90% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 341 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.