Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Ankyrin-3/ANK3 Protein, Human, Recombinant (hFc)

TargetMol | SPR
Catalog No. TMPH-04705 Copy Product Info
Ankyrin-3/ANK3 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q12955.

Ankyrin-3/ANK3 Protein, Human, Recombinant (hFc)

Catalog No. TMPH-04705
Copy Product Info
TargetMol | SPR

Ankyrin-3/ANK3 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q12955.

Ankyrin-3/ANK3 Protein, Human, Recombinant (hFc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$24320 days20 days
10 μg$39720 days20 days
20 μg$68520 days20 days
50 μg$1,19020 days20 days
100 μg$1,88020 days20 days
200 μg$2,89020 days20 days
500 μg$4,97020 days20 days
1 mg$7,88020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Ankyrin-3/ANK3 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q12955.
Species
Human
Expression System
HEK293 Cells
TagC-hFc
Accession NumberQ12955
Synonyms
Ankyrin-G,Ankyrin-3,ANK-3,ANK3
Amino Acid
ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG
Construction
4088-4199 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight41.5 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 342 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords