Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: Ankyrin-G, Ankyrin-3, ANK-3, ANK3


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $243 | 12 days | 12 days | |
| 10 µg | $397 | 12 days | 12 days | |
| 20 µg | $685 | 12 days | 12 days | |
| 50 µg | $1,190 | 12 days | 12 days | |
| 100 µg | $1,880 | 12 days | 12 days | |
| 200 µg | $2,890 | 12 days | 12 days | |
| 500 µg | $4,970 | 12 days | 12 days | |
| 1 mg | $7,880 | 12 days | 12 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Ankyrin-3/ANK3 Protein, Human, Recombinant (hFc) is expressed in Mammalian cell. The accession number is Q12955. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | C-hFc |
| Accession Number | Q12955 |
| Amino Acid | ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG |
| Construction | 4088-4199 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Ankyrin-G, Ankyrin-3, ANK-3, ANK3 |
| Molecular Weight | 41.5 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 342 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.