Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro).
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 284.00 | |
100 μg | 20 days | $ 536.00 | |
500 μg | 20 days | $ 1,480.00 |
Description | Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro). |
Species | Mouse |
Expression System | Yeast |
Tag | N-terminal 6xHis-sumostar-tagged |
Accession Number | Q3TMQ6 |
Synonyms | Ang4, Angiogenin-4, EC:3.1.27.- |
Amino Acid | QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 25-144 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 29.9 kDa (predicted) |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro). |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
Angiogenin-4 Protein, Mouse, Recombinant (His & SUMOstar) Ang4 Angiogenin-4 EC:3.1.27.- recombinant recombinant-proteins proteins protein