Shopping Cart
Remove All
Your shopping cart is currently empty
Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc)
(Synonyms: TsTX-III, TsTX III-8, Toxin T1-IV, Tityustoxin II (Toxin II;TsTX-II;Tst2), P-Mice-beta* NaTx5.1, Alpha-mammal toxin Ts2) Copy Product InfoSynonyms: TsTX-III, TsTX III-8, Toxin T1-IV, Tityustoxin II (Toxin II;TsTX-II;Tst2), P-Mice-beta* NaTx5.1, Alpha-mammal toxin Ts2
Catalog No. TMPH-03625 Copy Product Info
Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 10.9 kDa and the accession number is P68410.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $176 | 20 days | 20 days | |
| 10 μg | $293 | 20 days | 20 days | |
| 20 μg | $491 | 20 days | 20 days | |
| 50 μg | $926 | 20 days | 20 days | |
| 100 μg | $1,500 | 20 days | 20 days | |
| 200 μg | $1,830 | 20 days | 20 days | |
| 500 μg | $2,390 | 20 days | 20 days | |
| 1 mg | $2,960 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 10.9 kDa and the accession number is P68410. |
| Species | Tityus serrulatus |
| Expression System | Baculovirus Insect Cells |
| Tag | N-10xHis, C-Myc |
| Accession Number | P68410 |
| Amino Acid | KEGYAMDHEGCKFSCFIRPAGFCDGYCKTHLKASSGYCAWPACYCYGVPDHIKVWDYATNKC |
| Construction | 1-62 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | TsTX-III, TsTX III-8, Toxin T1-IV, Tityustoxin II (Toxin II;TsTX-II;Tst2), P-Mice-beta* NaTx5.1, Alpha-mammal toxin Ts2 |
| Research Background |
| Molecular Weight | 10.9 kDa (predicted) |
| Storage | Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Keywords
Preview
Related Tags: Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc) chemical structure | Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.