Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03625

Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 10.9 kDa and the accession number is P68410.

Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc)

Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03625
Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 10.9 kDa and the accession number is P68410.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$17620 days20 days
10 μg$29320 days20 days
20 μg$49120 days20 days
50 μg$92620 days20 days
100 μg$1,50020 days20 days
200 μg$1,83020 days20 days
500 μg$2,39020 days20 days
1 mg$2,96020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 10.9 kDa and the accession number is P68410.
Species
Tityus serrulatus
Expression System
Baculovirus Insect Cells
TagN-10xHis, C-Myc
Accession NumberP68410
Synonyms
TsTX-III,TsTX III-8,Toxin T1-IV,Tityustoxin II (Toxin II;TsTX-II;Tst2),P-Mice-beta* NaTx5.1,Alpha-mammal toxin Ts2
Amino Acid
KEGYAMDHEGCKFSCFIRPAGFCDGYCKTHLKASSGYCAWPACYCYGVPDHIKVWDYATNKC
Construction
1-62 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight10.9 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin acts on Nav1.2/SCN2A, Nav1.3/SCN3A, Nav1.5/SCN5A, Nav1.6/SCN8A and Nav1.7/SCN9A voltage-gated sodium channels, with the highest affinity for Nav1.3/SCN3A, followed by Nav1.6/SCN8A and Nav1.7/SCN9A which are affected almost equally. Interestingly, shows a significant shift of the voltage dependence of activation for Nav1.3/SCN3A that is characteristic of beta-toxins. In addition, in presence of LPS, this toxin inhibits the release of NO, IL-6 and TNF-alpha in J774.1 cells. Further, in the absence of LPS, it stimulates the production of the anti-inflammatory cytokine IL-10. This toxin is active on mammals.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords