Home Tools
Log in
Cart

Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc)

Catalog No. TMPH-03625
Synonyms: Tityustoxin II, TsTX III-8, Toxin II, Tst2, Toxin T1-IV, TsTX-II, TsTX-III, P-Mice-beta* NaTx5.1

Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc) is expressed in Baculovirus.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 491.00
100 μg 20 days $ 1,370.00
1 mg 20 days $ 2,750.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc) is expressed in Baculovirus.
Species Tityus serrulatus
Expression System Baculovirus
Tag N-terminal 10xHis-tagged and C-terminal Myc-tagged
Accession Number P68410
Synonyms Tityustoxin II, TsTX III-8, Toxin II, Tst2, Toxin T1-IV, TsTX-II, TsTX-III, P-Mice-beta* NaTx5.1
Amino Acid KEGYAMDHEGCKFSCFIRPAGFCDGYCKTHLKASSGYCAWPACYCYGVPDHIKVWDYATNKC Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 1-62 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 10.9 kDa (predicted)
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin acts on Nav1.2/SCN2A, Nav1.3/SCN3A, Nav1.5/SCN5A, Nav1.6/SCN8A and Nav1.7/SCN9A voltage-gated sodium channels, with the highest affinity for Nav1.3/SCN3A, followed by Nav1.6/SCN8A and Nav1.7/SCN9A which are affected almost equally. Interestingly, shows a significant shift of the voltage dependence of activation for Nav1.3/SCN3A that is characteristic of beta-toxins. In addition, in presence of LPS, this toxin inhibits the release of NO, IL-6 and TNF-alpha in J774.1 cells. Further, in the absence of LPS, it stimulates the production of the anti-inflammatory cytokine IL-10. This toxin is active on mammals.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc) Tityustoxin II TsTX III-8 Toxin II Tst2 Toxin T1-IV TsTX-II TsTX-III P-Mice-beta* NaTx5.1 recombinant recombinant-proteins proteins protein

 

TargetMol