Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Alpha-crystallin Protein, Mycobacterium bovis, Recombinant (His)

Catalog No. TMPH-02990

Acts as a chaperone. Alpha-crystallin Protein, Mycobacterium bovis, Recombinant (His) is expressed in Baculovirus insect cells with C-9xHis tag. The predicted molecular weight is 18.1 kDa and the accession number is P0A5B8.

Alpha-crystallin Protein, Mycobacterium bovis, Recombinant (His)

Alpha-crystallin Protein, Mycobacterium bovis, Recombinant (His)

Catalog No. TMPH-02990
Acts as a chaperone. Alpha-crystallin Protein, Mycobacterium bovis, Recombinant (His) is expressed in Baculovirus insect cells with C-9xHis tag. The predicted molecular weight is 18.1 kDa and the accession number is P0A5B8.
Pack SizePriceAvailabilityQuantity
20 μg$49120 days
100 μg$1,50020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Acts as a chaperone. Alpha-crystallin Protein, Mycobacterium bovis, Recombinant (His) is expressed in Baculovirus insect cells with C-9xHis tag. The predicted molecular weight is 18.1 kDa and the accession number is P0A5B8.
Species
Mycobacterium bovis
Expression System
Baculovirus Insect Cells
TagC-9xHis
Accession NumberP0A5B8
Synonyms
hspX,HSP 16.3,Alpha-crystallin,acr,Acr,16 kDa antigen,14 kDa antigen
Amino Acid
ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
Construction
2-144 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight18.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Acts as a chaperone.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords