Alpha-crystallin Protein, Mycobacterium bovis, Recombinant (His)

Catalog No. TMPH-02990 Copy Product Info

Acts as a chaperone. Alpha-crystallin Protein, Mycobacterium bovis, Recombinant (His) is expressed in Baculovirus insect cells with C-9xHis tag. The predicted molecular weight is 18.1 kDa and the accession number is P0A5B8.

Alpha-crystallin Protein, Mycobacterium bovis, Recombinant (His)

Catalog No. TMPH-02990

Copy Product Info

Alpha-crystallin Protein, Mycobacterium bovis, Recombinant (His)

Pack Size	Price	USA Stock	Global Stock
5 μg	$176	20 days	20 days
10 μg	$293	20 days	20 days
20 μg	$491	20 days	20 days
50 μg	$926	20 days	20 days
100 μg	$1,500	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Acts as a chaperone. Alpha-crystallin Protein, Mycobacterium bovis, Recombinant (His) is expressed in Baculovirus insect cells with C-9xHis tag. The predicted molecular weight is 18.1 kDa and the accession number is P0A5B8.
Species	Mycobacterium bovis
Expression System	Baculovirus Insect Cells
Tag	C-9xHis
Accession Number	P0A5B8
Synonyms	hspX,HSP 16.3,Alpha-crystallin,acr,16 kDa antigen,14 kDa antigen
Amino Acid	ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
Construction	2-144 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	18.1 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Acts as a chaperone.