Home Tools
Log in
Cart

Allergin-1 Protein, Mouse, Recombinant (His & Myc)

Catalog No. TMPH-02499
Synonyms: Mca32, Gm885, Allergy inhibitory receptor 1, Mast cell immunoglobulin-like receptor 1, Milr1, Mast cell antigen 32, Mast cell Ag-32, MCA-32

Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction. Allergin-1 Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.1 kDa and the accession number is Q3TB92.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Allergin-1 Protein, Mouse, Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction. Allergin-1 Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.1 kDa and the accession number is Q3TB92.
Species Mouse
Expression System E. coli
Tag N-10xHis, C-Myc
Accession Number Q3TB92
Synonyms Mca32, Gm885, Allergy inhibitory receptor 1, Mast cell immunoglobulin-like receptor 1, Milr1, Mast cell antigen 32, Mast cell Ag-32, MCA-32
Amino Acid ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLS
Construction 34-150 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 20.1 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Allergin-1 Protein, Mouse, Recombinant (His & Myc) Mca32 Gm885 Allergy inhibitory receptor 1 Mast cell immunoglobulin-like receptor 1 Milr1 Mast cell antigen 32 Mast cell Ag-32 MCA-32 recombinant recombinant-proteins proteins protein

 

TargetMol