All1616 Protein, Nostoc sp., Recombinant (His)

Name: All1616 Protein, Nostoc sp., Recombinant (His)
Brand: TargetMol
SKU: TMPH-03064
Rating: 4.5 (1 reviews)

Copy Product Info

Synonyms:

Catalog No. TMPH-03064 Copy Product Info

All1616 Protein, Nostoc sp., Recombinant (His) is expressed in E. coli.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	All1616 Protein, Nostoc sp., Recombinant (His) is expressed in E. coli.
Species	Nostoc
Expression System	E. coli
Tag	N-6xHis
Accession Number	Q8YWJ7
Amino Acid	MRWVDDSYLLPAAKGLMSTSVPNTYAKLAKALLINYSFDLSGYHVDELVNRWQKQYPADWLHLAVIEALYQGRYKAISVQQLLAFWQRRGQEIYHFNMEFERLICSKFPESLTPMAASEQYSRQGKNQNQTLQLMSFKQQEQVKEEEEPPTEKMLALSSTSVTASIEVSVSQQEDYLGQPFSLNPDISTKLLPISVTHPPIGQFTPQTSDRSESFTSKLKAISNENS
Construction	1-227 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Research Background	N/A

Chemical Properties

Molecular Weight

31.9 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.