Shopping Cart
Remove All
Your shopping cart is currently empty
Alkaline phosphatase/ALPI Protein, Human, Recombinant (His) V2
Catalog No. TMPY-02650U Copy Product Info
Alkaline phosphatase/ALPI Protein, Human, Recombinant (His) V2 is expressed in HEK293 Cells. The accession number is P09923.
Alkaline phosphatase/ALPI Protein, Human, Recombinant (His) V2
Catalog No. TMPY-02650U
Copy Product InfoAlkaline phosphatase/ALPI Protein, Human, Recombinant (His) V2 is expressed in HEK293 Cells. The accession number is P09923.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $75 | 20 days | 20 days | |
| 10 μg | $118 | 20 days | 20 days | |
| 20 μg | $196 | 20 days | 20 days | |
| 50 μg | $386 | 20 days | 20 days | |
| 100 μg | $660 | 20 days | 20 days | |
| 200 μg | $1,120 | 20 days | 20 days | |
| 500 μg | $2,270 | 20 days | 20 days |
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Resource Download
Product Information
| Biological Activity | Unit Definition: One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-phenylphosphate (pNPP), in 1 minute at 37°C, pH10.0. The specific activity is > 8836.463 U/mg. |
| Description | Alkaline phosphatase/ALPI Protein, Human, Recombinant (His) V2 is expressed in HEK293 Cells. The accession number is P09923. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | N-10xHis |
| Accession Number | P09923 |
| Synonyms | IAP,alkaline phosphatase, intestinal |
| Amino Acid | VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD |
| Construction | 20-503 aa |
| Protein Purity | > 95% as determined by SDS-PAGE. |
| Molecular Weight | 55.2 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Keywords
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.