Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Alginate lyase Protein, Pseudomonas fluorescens, Recombinant (His & Myc)

Catalog No. TMPH-03183

Catalyzes the depolymerization of alginate by cleaving the beta-1,4 glycosidic bond between two adjacent sugar residues via a beta-elimination mechanism. May serve to degrade mislocalized alginate that is trapped in the periplasmic space. Alginate lyase Protein, Pseudomonas fluorescens, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 47.1 kDa and the accession number is P59786.

Alginate lyase Protein, Pseudomonas fluorescens, Recombinant (His & Myc)

Alginate lyase Protein, Pseudomonas fluorescens, Recombinant (His & Myc)

Catalog No. TMPH-03183
Catalyzes the depolymerization of alginate by cleaving the beta-1,4 glycosidic bond between two adjacent sugar residues via a beta-elimination mechanism. May serve to degrade mislocalized alginate that is trapped in the periplasmic space. Alginate lyase Protein, Pseudomonas fluorescens, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 47.1 kDa and the accession number is P59786.
Pack SizePriceAvailabilityQuantity
20 μg$36020 days
100 μg$74520 days
1 mg$2,53020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Catalyzes the depolymerization of alginate by cleaving the beta-1,4 glycosidic bond between two adjacent sugar residues via a beta-elimination mechanism. May serve to degrade mislocalized alginate that is trapped in the periplasmic space. Alginate lyase Protein, Pseudomonas fluorescens, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 47.1 kDa and the accession number is P59786.
Species
Pseudomonas fluorescens
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberP59786
Synonyms
Poly(beta-D-mannuronate) lyase,algL,Alginate lyase
Amino Acid
AAPLRPPQGYFAPVEAFKTGDFKNDCDAMPPPYTGSLQFRSKYEGSDKARSTLNVQSEKAFRDSTADITKLEKDTSKRVMQFMRDGRPEQLECTLNWLTSWAKADALMSKDFNHTGKSMRKWALGSMASAYVRLKFSDSHPLANHQQESQLIEAWFNKLADQVVSDWDNLPLEKTNNHSYWAAWSVMATSVATNRRDLFDWAVKEYKVGVNQVDDQGFLPNELKRQQRALSYHNYALPPLSMIASFALVNGVDLRQENNSALKRLGDKVLAGVKDPEIFEKKNGKEQDMKDLKEDMKYAWLEPFCTLYTCAPDVIERKHGMQPFKTFRLGGDLTKVYDPTHEKGNKGS
Construction
26-373 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight47.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Catalyzes the depolymerization of alginate by cleaving the beta-1,4 glycosidic bond between two adjacent sugar residues via a beta-elimination mechanism. May serve to degrade mislocalized alginate that is trapped in the periplasmic space.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords