Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

AK3 Protein, Human, Recombinant (His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01417 Copy Product Info
AK3 Protein, Human, Recombinant (His & Myc) is expressed in E. coli.

AK3 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01417
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

AK3 Protein, Human, Recombinant (His & Myc) is expressed in E. coli.

AK3 Protein, Human, Recombinant (His & Myc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$10520 days20 days
10 μg$16920 days20 days
20 μg$28320 days20 days
50 μg$42820 days20 days
100 μg$59020 days20 days
200 μg$91320 days20 days
500 μg$1,62020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
AK3 Protein, Human, Recombinant (His & Myc) is expressed in E. coli.
Species
Human
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberQ9UIJ7
Synonyms
mitochondrial,GTP:AMP phosphotransferase AK3, mitochondrial,AKL3L,AK6,AK3L1,AK3,Adenylate kinase isozyme 3,Adenylate kinase 3 alpha-like 1,Adenylate kinase 3
Amino Acid
MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
Construction
1-227 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight32.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Has GTP:AMP phosphotransferase and ITP:AMP phosphotransferase activities.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords