Home Tools
Log in
Cart

Adrenodoxin, mitochondrial Protein, Bovine, Recombinant (His)

Catalog No. TMPH-00220
Synonyms: Hepato-ferredoxin, FDX1, Ferredoxin-1, Adrenodoxin, mitochondrial, ADX, Adrenal ferredoxin

Essential for the synthesis of various steroid hormones. Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage to produce pregnenolone, the precursor of most steroid hormones. Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Adrenodoxin, mitochondrial Protein, Bovine, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Essential for the synthesis of various steroid hormones. Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage to produce pregnenolone, the precursor of most steroid hormones. Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons.
Species Bovine
Expression System E. coli
Tag N-terminal 10xHis-tagged
Accession Number P00257
Synonyms Hepato-ferredoxin, FDX1, Ferredoxin-1, Adrenodoxin, mitochondrial, ADX, Adrenal ferredoxin
Amino Acid SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 59-186 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 19.5 kDa (predicted)
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Essential for the synthesis of various steroid hormones. Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage to produce pregnenolone, the precursor of most steroid hormones. Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Adrenodoxin, mitochondrial Protein, Bovine, Recombinant (His) Hepato-ferredoxin FDX1 Ferredoxin-1 Adrenodoxin, mitochondrial ADX Adrenal ferredoxin recombinant recombinant-proteins proteins protein

 

TargetMol