ALK-1 Protein, Human, Recombinant (Baculovirus, His)

Catalog No. TMPH-04120

ACVRL1 Protein, Human, Recombinant (His) is expressed in Baculovirus Insect Cells with C-6xHis. The accession number is P37023.

ALK-1 Protein, Human, Recombinant (Baculovirus, His)

Catalog No. TMPH-04120

ACVRL1 Protein, Human, Recombinant (His) is expressed in Baculovirus Insect Cells with C-6xHis. The accession number is P37023.

Pack Size	Price	Availability
5 μg	$119	20 days
10 μg	$196	20 days
20 μg	$326	20 days
50 μg	$586	20 days
100 μg	$918	20 days
200 μg	$1,180	20 days
500 μg	$1,730	20 days
1 mg	$2,290	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized Human ACVRL1 at 2 μg/mL can bind Anti-ACVRL1 recombinant antibody(CSB-RA001262MA1HU), the EC50 is 2.417-2.971 ng/mL.
Description	ACVRL1 Protein, Human, Recombinant (His) is expressed in Baculovirus Insect Cells with C-6xHis. The accession number is P37023.
Species	Human
Expression System	Baculovirus Insect Cells
Tag	C-6xHis
Accession Number	P37023
Synonyms	TGF-B superfamily receptor type I (TSR-I),Serine/threonine-protein kinase receptor R3 (SKR3),ALK1,ACVRLK1,ACVRL1,Activin receptor-like kinase 1 (ALK-1),Activin receptor type-1-like
Amino Acid	DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ
Construction	22-118 aa
Protein Purity	>95% as determined by SDS-PAGE.
Molecular Weight	11.5 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.