Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

ALK-1 Protein, Human, Recombinant (Baculovirus, His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04120 Copy Product Info
ACVRL1 Protein, Human, Recombinant (His) is expressed in Baculovirus Insect Cells with C-6xHis. The accession number is P37023.

ALK-1 Protein, Human, Recombinant (Baculovirus, His)

Catalog No. TMPH-04120
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

ACVRL1 Protein, Human, Recombinant (His) is expressed in Baculovirus Insect Cells with C-6xHis. The accession number is P37023.

ALK-1 Protein, Human, Recombinant (Baculovirus, His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$11920 days20 days
10 μg$19620 days20 days
20 μg$32620 days20 days
50 μg$58620 days20 days
100 μg$91820 days20 days
200 μg$1,18020 days20 days
500 μg$1,73020 days20 days
1 mg$2,29020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ACVRL1 at 2 μg/mL can bind Anti-ACVRL1 recombinant antibody(CSB-RA001262MA1HU), the EC50 is 2.417-2.971 ng/mL.
Description
ACVRL1 Protein, Human, Recombinant (His) is expressed in Baculovirus Insect Cells with C-6xHis. The accession number is P37023.
Species
Human
Expression System
Baculovirus Insect Cells
TagC-6xHis
Accession NumberP37023
Synonyms
TGF-B superfamily receptor type I (TSR-I),Serine/threonine-protein kinase receptor R3 (SKR3),ALK1,ACVRLK1,ACVRL1,Activin receptor-like kinase 1 (ALK-1),Activin receptor type-1-like
Amino Acid
DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ
Construction
22-118 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight11.5 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords