Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: TGF-B superfamily receptor type I (TSR-I), Serine/threonine-protein kinase receptor R3 (SKR3), ALK1, ACVRLK1, ACVRL1, Activin receptor-like kinase 1 (ALK-1), Activin receptor type-1-like


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $119 | 12 days | 12 days | |
| 10 µg | $196 | 12 days | 12 days | |
| 20 µg | $326 | 12 days | 12 days | |
| 50 µg | $586 | 12 days | 12 days | |
| 100 µg | $918 | 12 days | 12 days | |
| 200 µg | $1,180 | 12 days | 12 days | |
| 500 µg | $1,730 | 12 days | 12 days | |
| 1 mg | $2,290 | 12 days | 12 days |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized Human ACVRL1 at 2 μg/mL can bind Anti-ACVRL1 recombinant antibody(CSB-RA001262MA1HU), the EC50 is 2.417-2.971 ng/mL. |
| Description | ACVRL1 Protein, Human, Recombinant (His) is expressed in Baculovirus Insect Cells with C-6xHis. The accession number is P37023. |
| Species | Human |
| Expression System | Baculovirus Insect Cells |
| Tag | C-6xHis |
| Accession Number | P37023 |
| Amino Acid | DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ |
| Construction | 22-118 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | TGF-B superfamily receptor type I (TSR-I), Serine/threonine-protein kinase receptor R3 (SKR3), ALK1, ACVRLK1, ACVRL1, Activin receptor-like kinase 1 (ALK-1), Activin receptor type-1-like |
| Molecular Weight | 11.5 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.