14-3-3 sigma Protein, Human, Recombinant (PBS, GST)

Name: 14-3-3 sigma Protein, Human, Recombinant (PBS, GST)
Brand: TargetMol
SKU: TMPY-01263-SPR
Rating: 4.5 (1 reviews)

(Synonyms: Stratifin, SFN, HME1, Epithelial cell marker protein 1, 14-3-3 protein sigma) Copy Product Info

Synonyms: Stratifin, SFN, HME1, Epithelial cell marker protein 1, 14-3-3 protein sigma

Catalog No. TMPY-01263-SPR Copy Product Info

14-3-3 sigma Protein, Human, Recombinant (PBS, GST) is expressed in E. coli. The accession number is P31947.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$87	20 days	20 days
10 µg	$138	20 days	20 days
20 µg	$232	20 days	20 days
50 µg	$330	20 days	20 days
100 µg	$493	20 days	20 days
200 µg	$667	20 days	20 days
500 µg	$1,200	20 days	20 days
1 mg	$2,160	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	14-3-3 sigma Protein, Human, Recombinant (PBS, GST) is expressed in E. coli. The accession number is P31947.
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	P31947
Amino Acid	MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Construction	1-248 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Stratifin, SFN, HME1, Epithelial cell marker protein 1, 14-3-3 protein sigma

Chemical Properties

Molecular Weight

54.8 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 439 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

HME-11433 protein sigma

Related Tags: 14-3-3 sigma Protein, Human, Recombinant (PBS, GST) chemical structure | 14-3-3 sigma Protein, Human, Recombinant (PBS, GST) molecular weight