Shopping Cart
Remove All
Your shopping cart is currently empty
PPAR alpha/PPARA Protein, Human, Recombinant (His) is expressed in E. coli expression system with His tag. The predicted molecular weight is 31.36 kDa and the accession number is Q07869.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $109 | - | In Stock | |
| 10 μg | $182 | - | In Stock | |
| 20 μg | $296 | 7-10 days | 7-10 days | |
| 50 μg | $600 | In Stock | In Stock | |
| 100 μg | $1,050 | 7-10 days | 7-10 days | |
| 200 μg | $1,830 | 7-10 days | 7-10 days | |
| 500 μg | $3,910 | 7-10 days | 7-10 days |
| Biological Activity | Activity testing is in progress. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | PPAR alpha/PPARA Protein, Human, Recombinant (His) is expressed in E. coli expression system with His tag. The predicted molecular weight is 31.36 kDa and the accession number is Q07869. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | Q07869 |
| Synonyms | PPARα,PPARalpha,PPAR,peroxisome proliferator-activated receptor α,peroxisome proliferator-activated receptor alpha,NR1C1,hPPAR |
| Amino Acid | MHHHHHHTADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY |
| Construction | A DNA sequence encoding the Human PPARA (Q07869) (Thr200-Tyr468) was expressed, with a polyhistidine tag at the N-terminus. Predicted N terminal: Met |
| Protein Purity | ≥ 90 % as determined by SDS-PAGE. |
| Molecular Weight | 31.36 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a solution filtered through a 0.22 μm filter, containing PBS, 10% Glycerol, 0.5% SKL, pH 8.0.Typically, a mixture containing 5% to 8% trehalose, mannitol, and 0.01% Tween 80 is incorporated as a protective agent before lyophilization. |
| Reconstitution | Reconstituted with sterile deionized water to 0.24 mg/mL. Reconstitution conditions may vary depending on the lot. |
| Stability & Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers; this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and animals that contain enzymes for respiration and for cholesterol and lipid metabolism. The action of peroxisome proliferators is thought to be mediated via specific receptors, called PPARs, which belong to the steroid hormone receptor superfamily. PPARs affect the expression of target genes involved in cell proliferation, cell differentiation and in immune and inflammation responses. Three closely related subtypes (alpha, beta/delta, and gamma) have been identified. This gene encodes the subtype PPAR-alpha, which is a nuclear transcription factor. Multiple alternatively spliced transcript variants have been described for this gene, although the full-length nature of only two has been determined.Cancer ImmunotherapyImmune CheckpointImmunotherapyTargeted Therapy |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.