Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

PPAR alpha/PPARA Protein, Human, Recombinant (His)

Catalog No. TMPY-06830 Copy Product Info
PPAR alpha/PPARA Protein, Human, Recombinant (His) is expressed in E. coli expression system with His tag. The predicted molecular weight is 31.36 kDa and the accession number is Q07869.

PPAR alpha/PPARA Protein, Human, Recombinant (His)

Catalog No. TMPY-06830
Copy Product Info

PPAR alpha/PPARA Protein, Human, Recombinant (His) is expressed in E. coli expression system with His tag. The predicted molecular weight is 31.36 kDa and the accession number is Q07869.

PPAR alpha/PPARA Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$109-In Stock
10 μg$182-In Stock
20 μg$2967-10 days7-10 days
50 μg$600In StockIn Stock
100 μg$1,0507-10 days7-10 days
200 μg$1,8307-10 days7-10 days
500 μg$3,9107-10 days7-10 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity testing is in progress. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
PPAR alpha/PPARA Protein, Human, Recombinant (His) is expressed in E. coli expression system with His tag. The predicted molecular weight is 31.36 kDa and the accession number is Q07869.
Species
Human
Expression System
E. coli
TagN-6xHis
Accession NumberQ07869
Synonyms
PPARα,PPARalpha,PPAR,peroxisome proliferator-activated receptor α,peroxisome proliferator-activated receptor alpha,NR1C1,hPPAR
Amino Acid
MHHHHHHTADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Construction
A DNA sequence encoding the Human PPARA (Q07869) (Thr200-Tyr468) was expressed, with a polyhistidine tag at the N-terminus. Predicted N terminal: Met
Protein Purity
≥ 90 % as determined by SDS-PAGE.
Molecular Weight31.36 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a solution filtered through a 0.22 μm filter, containing PBS, 10% Glycerol, 0.5% SKL, pH 8.0.Typically, a mixture containing 5% to 8% trehalose, mannitol, and 0.01% Tween 80 is incorporated as a protective agent before lyophilization.
Reconstitution
Reconstituted with sterile deionized water to 0.24 mg/mL. Reconstitution conditions may vary depending on the lot.
Stability & Storage
It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers; this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and animals that contain enzymes for respiration and for cholesterol and lipid metabolism. The action of peroxisome proliferators is thought to be mediated via specific receptors, called PPARs, which belong to the steroid hormone receptor superfamily. PPARs affect the expression of target genes involved in cell proliferation, cell differentiation and in immune and inflammation responses. Three closely related subtypes (alpha, beta/delta, and gamma) have been identified. This gene encodes the subtype PPAR-alpha, which is a nuclear transcription factor. Multiple alternatively spliced transcript variants have been described for this gene, although the full-length nature of only two has been determined.Cancer ImmunotherapyImmune CheckpointImmunotherapyTargeted Therapy

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.