PPAR alpha/PPARA Protein, Human, Recombinant (His)

Name: PPAR alpha/PPARA Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPY-06830
Price: 109 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: PPARα, PPARalpha, PPAR, peroxisome proliferator-activated receptor α, peroxisome proliferator-activated receptor alpha, NR1C1, hPPAR) Copy Product Info

Synonyms: PPARα, PPARalpha, PPAR, peroxisome proliferator-activated receptor α, peroxisome proliferator-activated receptor alpha, NR1C1, hPPAR

Catalog No. TMPY-06830 Copy Product Info

PPAR alpha/PPARA Protein, Human, Recombinant (His) is expressed in E. coli expression system with His tag. The predicted molecular weight is 31.36 kDa and the accession number is Q07869.

Pack Size	Price	USA Stock	Global Stock
5 μg	$109	-	In Stock
10 μg	$182	-	In Stock
20 μg	$296	7-10 days	7-10 days
50 μg	$600	In Stock	In Stock
100 μg	$1,050	7-10 days	7-10 days
200 μg	$1,830	7-10 days	7-10 days
500 μg	$3,910	7-10 days	7-10 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	PPAR alpha/PPARA Protein, Human, Recombinant (His) is expressed in E. coli expression system with His tag. The predicted molecular weight is 31.36 kDa and the accession number is Q07869.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	Q07869
Amino Acid	MHHHHHHTADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Construction	A DNA sequence encoding the Human PPARA (Q07869) (Thr200-Tyr468) was expressed, with a polyhistidine tag at the N-terminus. Predicted N terminal: Met
Protein Purity	≥ 90 % as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a solution filtered through a 0.22 μm filter, containing PBS, 10% Glycerol, 0.5% SKL, pH 8.0.Typically, a mixture containing 5% to 8% trehalose, mannitol, and 0.01% Tween 80 is incorporated as a protective agent before lyophilization.
Reconstitution	Reconstituted with sterile deionized water to 0.24 mg/mL. Reconstitution conditions may vary depending on the lot.
Stability & Storage	It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	PPARα, PPARalpha, PPAR, peroxisome proliferator-activated receptor α, peroxisome proliferator-activated receptor alpha, NR1C1, hPPAR
Research Background

Chemical Properties

Molecular Weight

31.36 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Related Tags: PPAR alpha/PPARA Protein, Human, Recombinant (His) chemical structure | PPAR alpha/PPARA Protein, Human, Recombinant (His) molecular weight