Shopping Cart
Remove All
Your shopping cart is currently empty
Anti-SUMO tag Antibody (5Y461)
😃Good
Catalog No. TMAS-00131
Anti-SUMO tag Antibody (5Y461) is a Mouse antibody targeting SUMO tag. Anti-SUMO tag Antibody (5Y461) can be used in ELISA, WB.
Anti-SUMO tag Antibody (5Y461)
Anti-SUMO tag Antibody (5Y461)
😃Good
Catalog No. TMAS-00131
Anti-SUMO tag Antibody (5Y461) is a Mouse antibody targeting SUMO tag. Anti-SUMO tag Antibody (5Y461) can be used in ELISA, WB.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 40 μg | $305 | 7-10 days | 7-10 days |
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Resource Download
Product Introduction
Bioactivity
Related Conjugates and Formulations
Antigen Details
Chemical Properties
| Description | Anti-SUMO tag Antibody (5Y461) is a Mouse antibody targeting SUMO tag. Anti-SUMO tag Antibody (5Y461) can be used in ELISA, WB. |
| Ig Type | IgG2a,κ |
| Clone | 5Y461 |
| Specificity | Fusion proteins containing SUMO epitope tags |
| Verified Activity | 1. Western Blot of SUMO protein with Anti-SUMO tag Antibody (5Y461) (TMAS-00131). Lane 1: 20 ng SUMO protein Lane 2: 10 ng SUMO protein Lane 3: 5 ng SUMO protein Primary Antibody: Anti-SUMO tag Antibody (5Y461) (TMAS-00131), 1 µg/ml. Secondary Antibody: Peroxidase-AffiniPure Goat Anti-Mouse IgG, Fcγ Fragment Specific, 0.2 μg/ml Predicted Size: 11 kD Observed Size: 18 kD 2. Western blot analysis of SUMO-tagged fusion protein using Anti-SUMO tag Antibody (5Y461) (TMAS-00131). The signal was developed with IRDyeTM800 Conjugated Goat Anti-Mouse IgG. Predicted Size: 62 kD Observed Size: 62 kD |
| Application | |
| Recommended Dose | ELISA: 0.05-0.2 µg/ml; WB: 0.5-1 µg/ml |
| Antibody Type | Monoclonal |
| Host Species | Mouse |
| Purification | Protein A affinity column |
| Appearance | Lyophilized. Reconstitute the lyophilized powder with deionized water (or equivalent) to a final concentration of 0.5 mg/mL. |
| Formulation | Lyophilized with PBS, pH 7.4, containing 0.02% sodium azide. |
| Research Background | SUMO tags are emerging as a viable alternative for increasing both the expression and solubility of otherwise hard-to-express proteins. The SUMO tag can be cleanly excised using SUMO protease, which recognizes the conformation of SUMO protein rather than a specific sequence within SUMO. The SUMO system can be used effectively in both prokaryotic and eukaryotic systems. |
| Conjucates | Unconjugated |
| Immunogen | Recombinant Protein: yeast SUMO protein (DSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDG IRIQADQAPEDLDMEDNDIIEAHREQIGG) |
Stability & Storage
| Stability & Storage | The lyophilized product store at -20°C or -80°C for 12 months. The reconstituted antibody can be stored at 2°C-8°C for 2-3 weeks or at -20°C for 12 months. Avoid repeated freeze-thaw cycles. |
| Transport | Shipping with blue ice. |
Calculator
For example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . 
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: buy Anti-SUMO tag Antibody (5Y461) | purchase Anti-SUMO tag Antibody (5Y461) | Anti-SUMO tag Antibody (5Y461) cost | order Anti-SUMO tag Antibody (5Y461)
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.