Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Anti-SUMO tag Antibody (5Y461)

Catalog No. TMAS-00131 Copy Product Info
🥰Excellent
Anti-SUMO tag Antibody (5Y461) is a Mouse antibody targeting SUMO tag. Anti-SUMO tag Antibody (5Y461) can be used in ELISA, WB.

Anti-SUMO tag Antibody (5Y461)

Copy Product Info
🥰Excellent
Catalog No. TMAS-00131

Anti-SUMO tag Antibody (5Y461) is a Mouse antibody targeting SUMO tag. Anti-SUMO tag Antibody (5Y461) can be used in ELISA, WB.

Anti-SUMO tag Antibody
(5Y461)
Pack SizePriceUSA StockGlobal StockQuantity
40 μg$3057-10 days7-10 days
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
TargetMol
View More

Product Introduction

Bioactivity
Description
Anti-SUMO tag Antibody (5Y461) is a Mouse antibody targeting SUMO tag. Anti-SUMO tag Antibody (5Y461) can be used in ELISA, WB.
Ig Type
IgG2a,κ
Clone
5Y461
Specificity
Fusion proteins containing SUMO epitope tags
Verified Activity
1. Western Blot of SUMO protein with Anti-SUMO tag Antibody (5Y461) (TMAS-00131).
Lane 1: 20 ng SUMO protein
Lane 2: 10 ng SUMO protein
Lane 3: 5 ng SUMO protein
Primary Antibody: Anti-SUMO tag Antibody (5Y461) (TMAS-00131), 1 µg/ml.
Secondary Antibody: Peroxidase-AffiniPure Goat Anti-Mouse IgG, Fcγ Fragment Specific, 0.2 μg/ml
Predicted Size: 11 kD
Observed Size: 18 kD
2. Western blot analysis of SUMO-tagged fusion protein using Anti-SUMO tag Antibody (5Y461) (TMAS-00131).
The signal was developed with IRDyeTM800 Conjugated Goat Anti-Mouse IgG.
Predicted Size: 62 kD
Observed Size: 62 kD
Application
Recommended Dose
ELISA: 0.05-0.2 µg/ml; WB: 0.5-1 µg/ml
Antibody Type
Monoclonal
Host SpeciesMouse
PurificationProtein A affinity column
AppearanceLyophilized. Reconstitute the lyophilized powder with deionized water (or equivalent) to a final concentration of 0.5 mg/mL.
FormulationLyophilized with PBS, pH 7.4, containing 0.02% sodium azide.
Research BackgroundSUMO tags are emerging as a viable alternative for increasing both the expression and solubility of otherwise hard-to-express proteins. The SUMO tag can be cleanly excised using SUMO protease, which recognizes the conformation of SUMO protein rather than a specific sequence within SUMO. The SUMO system can be used effectively in both prokaryotic and eukaryotic systems.
Related Conjugates and Formulations
Conjucates
Unconjugated
Antigen Details
Immunogen
Recombinant Protein: yeast SUMO protein (DSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDG IRIQADQAPEDLDMEDNDIIEAHREQIGG)
Chemical Properties
Stability & Storage
Stability & StorageThe lyophilized product store at -20°C or -80°C for 12 months. The reconstituted antibody can be stored at 2°C-8°C for 2-3 weeks or at -20°C for 12 months. Avoid repeated freeze-thaw cycles.
TransportShipping with blue ice.

Calculator

  • Dilution Calculator
  • Reconstitution Calculator
Related Tags: buy Anti-SUMO tag Antibody (5Y461) | purchase Anti-SUMO tag Antibody (5Y461) | Anti-SUMO tag Antibody (5Y461) cost | order Anti-SUMO tag Antibody (5Y461)