Shopping Cart
Remove All
Your shopping cart is currently empty
Anti-SUMO tag Antibody (5Y461) is a Mouse antibody targeting SUMO tag. Anti-SUMO tag Antibody (5Y461) can be used in ELISA, WB.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 40 μg | $305 | 7-10 days | 7-10 days |
| Description | Anti-SUMO tag Antibody (5Y461) is a Mouse antibody targeting SUMO tag. Anti-SUMO tag Antibody (5Y461) can be used in ELISA, WB. |
| Ig Type | IgG2a,κ |
| Clone | 5Y461 |
| Specificity | Fusion proteins containing SUMO epitope tags |
| Verified Activity | 1. Western Blot of SUMO protein with Anti-SUMO tag Antibody (5Y461) (TMAS-00131). Lane 1: 20 ng SUMO protein Lane 2: 10 ng SUMO protein Lane 3: 5 ng SUMO protein Primary Antibody: Anti-SUMO tag Antibody (5Y461) (TMAS-00131), 1 µg/ml. Secondary Antibody: Peroxidase-AffiniPure Goat Anti-Mouse IgG, Fcγ Fragment Specific, 0.2 μg/ml Predicted Size: 11 kD Observed Size: 18 kD 2. Western blot analysis of SUMO-tagged fusion protein using Anti-SUMO tag Antibody (5Y461) (TMAS-00131). The signal was developed with IRDyeTM800 Conjugated Goat Anti-Mouse IgG. Predicted Size: 62 kD Observed Size: 62 kD |
| Application | |
| Recommended Dose | ELISA: 0.05-0.2 µg/ml; WB: 0.5-1 µg/ml |
| Antibody Type | Monoclonal |
| Host Species | Mouse |
| Purification | Protein A affinity column |
| Appearance | Lyophilized. Reconstitute the lyophilized powder with deionized water (or equivalent) to a final concentration of 0.5 mg/mL. |
| Formulation | Lyophilized with PBS, pH 7.4, containing 0.02% sodium azide. |
| Research Background | SUMO tags are emerging as a viable alternative for increasing both the expression and solubility of otherwise hard-to-express proteins. The SUMO tag can be cleanly excised using SUMO protease, which recognizes the conformation of SUMO protein rather than a specific sequence within SUMO. The SUMO system can be used effectively in both prokaryotic and eukaryotic systems. |
| Conjucates | Unconjugated |
| Immunogen | Recombinant Protein: yeast SUMO protein (DSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDG IRIQADQAPEDLDMEDNDIIEAHREQIGG) |
| Stability & Storage | The lyophilized product store at -20°C or -80°C for 12 months. The reconstituted antibody can be stored at 2°C-8°C for 2-3 weeks or at -20°C for 12 months. Avoid repeated freeze-thaw cycles. |
| Transport | Shipping with blue ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.