Shopping Cart
Remove All
Your shopping cart is currently empty
Anti-SUMO tag Antibody (5Y461)
Copy Product Info
🥰Excellent
Synonyms:
Catalog No. TMAS-00131 Copy Product Info
🥰Excellent
Anti-SUMO tag Antibody (5Y461) is a Mouse antibody targeting SUMO tag. Anti-SUMO tag Antibody (5Y461) can be used in ELISA, WB.
Anti-SUMO tag Antibody
(5Y461)
(5Y461)
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 40 μg | $305 | 7-10 days | 7-10 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Related Conjugates and Formulations
Antigen Details
Chemical Properties
Stability & Storage
| Description | Anti-SUMO tag Antibody (5Y461) is a Mouse antibody targeting SUMO tag. Anti-SUMO tag Antibody (5Y461) can be used in ELISA, WB. |
| Ig Type | IgG2a,κ |
| Clone | 5Y461 |
| Specificity | Fusion proteins containing SUMO epitope tags |
| Application | |
| Recommended Dose | ELISA: 0.05-0.2 µg/ml; WB: 0.5-1 µg/ml |
| Antibody Type | Monoclonal |
| Host Species | Mouse |
| Purification | Protein A affinity column |
| Appearance | Lyophilized. Reconstitute the lyophilized powder with deionized water (or equivalent) to a final concentration of 0.5 mg/mL. |
| Formulation | Lyophilized with PBS, pH 7.4, containing 0.02% sodium azide. |
| Research Background | SUMO tags are emerging as a viable alternative for increasing both the expression and solubility of otherwise hard-to-express proteins. The SUMO tag can be cleanly excised using SUMO protease, which recognizes the conformation of SUMO protein rather than a specific sequence within SUMO. The SUMO system can be used effectively in both prokaryotic and eukaryotic systems. |
| Conjucates | Unconjugated |
| Immunogen | Recombinant Protein: yeast SUMO protein (DSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDG IRIQADQAPEDLDMEDNDIIEAHREQIGG) |
| Stability & Storage | The lyophilized product store at -20°C or -80°C for 12 months. The reconstituted antibody can be stored at 2°C-8°C for 2-3 weeks or at -20°C for 12 months. Avoid repeated freeze-thaw cycles. |
| Transport | Shipping with blue ice. |
Calculator
Preview
Related Tags:
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.