Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.

Zinc metalloproteinase aureolysin Protein, S. aureus, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 40.2 kDa and the accession number is P81177.

Staphylococcus aureus

E. coli

Zinc metalloproteinase aureolysin,Staphylococcus aureus neutral proteinase,aur

AATGTGKGVLGDTKDININSIDGGFSLEDLTHQGKLSAYNFNDQTGQATLITNEDENFVKDDQRAGVDANYYAKQTYDYYKNTFGRESYDNHGSPIVSLTHVNHYGGQDNRNNAAWIGDKMIYGDGDGRTFTNLSGANDVVAHELTHGVTQETANLEYKDQSGALNESFSDVFGYFVDDEDFLMGEDVYTPGKEGDALRSMSNPEQFGQPSHMKDYVYTEKDNGGVHTNSGIPNKAAYNVIQAIGKSKSEQIYYRALTEYLTSNSNFKDCKDALYQAAKDLYDEQTAEQVYEAWNEVGVE

210-509 aa

> 85% as determined by SDS-PAGE.

A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Plays an essential role in immune evasion by helping bacteria to resist complement-mediated killing by neutrophils. Inhibits the deposition of host C3b on bacterial surfaces and the release of the chemoattractant C5a by cleaving the central complement protein C3. The cleavage site renders the C3b molecule vulnerable to proteolytic degradation by host regulators. Cleaves and inactivates host SERPINA1, which is an endogenous protease inhibitor essential for controlling neutrophil serine protease elastase. Plays also an essential role in the cleavage and subsequent activation of the serine protease SspA which is involved in colonization and infection of human tissues.