TMLHE Protein, Human, Recombinant (His)

Name: TMLHE Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04548
Rating: 4.5 (1 reviews)

(Synonyms: Trimethyllysine dioxygenase, mitochondrial, TMLHE, TMLH, TML-alpha-ketoglutarate dioxygenase (TML dioxygenase;TMLD), TML hydroxylase, Epsilon-trimethyllysine hydroxylase, Epsilon-trimethyllysine 2-oxoglutarate dioxygenase) Copy Product Info

Synonyms: Trimethyllysine dioxygenase, mitochondrial, TMLHE, TMLH, TML-alpha-ketoglutarate dioxygenase (TML dioxygenase;TMLD), TML hydroxylase, Epsilon-trimethyllysine hydroxylase, Epsilon-trimethyllysine 2-oxoglutarate dioxygenase

Catalog No. TMPH-04548 Copy Product Info

TMLHE Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9NVH6.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$87	20 days	20 days
10 μg	$139	20 days	20 days
20 μg	$232	20 days	20 days
50 μg	$329	20 days	20 days
100 μg	$435	20 days	20 days
200 μg	$673	20 days	20 days
500 μg	$1,180	20 days	20 days
1 mg	$1,870	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	TMLHE Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9NVH6.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	Q9NVH6
Amino Acid	LLKGGVIYPALPQPNFKSLLPLAVHWHHTASKSLTCAWQQHEDHFELKYANTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTIRLDETTLFFTWPDGHVTKYDLNWLVKNSYEGQKQKVIQPRILWNAEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPVLNIYPWNKELYLIRLFKEKQNTVNRQWNSSLQCDIPERILTYRHFVSGTSIEHRGSLI
Construction	16-376 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 185 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Trimethyllysine dioxygenase, mitochondrial, TMLHE, TMLH, TML-alpha-ketoglutarate dioxygenase (TML dioxygenase;TMLD), TML hydroxylase, Epsilon-trimethyllysine hydroxylase, Epsilon-trimethyllysine 2-oxoglutarate dioxygenase

Chemical Properties

Molecular Weight

46.1 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Related Tags: TMLHE Protein, Human, Recombinant (His) chemical structure | TMLHE Protein, Human, Recombinant (His) molecular weight