TFF3 Protein, Human, Recombinant

Name: TFF3 Protein, Human, Recombinant
Brand: TargetMol
SKU: TMPH-04169
Rating: 4.5 (1 reviews)

(Synonyms: Trefoil factor 3, TFI, TFF3, Polypeptide P1.B (hP1.B), ITF, Intestinal trefoil factor (hITF)) Copy Product Info

Synonyms: Trefoil factor 3, TFI, TFF3, Polypeptide P1.B (hP1.B), ITF, Intestinal trefoil factor (hITF)

Catalog No. TMPH-04169 Copy Product Info

TFF3 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q07654.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$147	7-10 days	7-10 days
10 µg	$223	7-10 days	7-10 days
20 µg	$382	7-10 days	7-10 days
50 µg	$739	7-10 days	7-10 days
100 µg	$1,220	7-10 days	7-10 days
200 µg	$1,720	7-10 days	7-10 days
500 µg	$2,730	7-10 days	7-10 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human MCF-7 cells is less than 10 μg/ml, corresponding to a specific activity of ＞ 100 IU/mg.
Description	TFF3 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q07654.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	Q07654
Amino Acid	EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Construction	22-80 aa
Protein Purity	>97% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 150mM NaCl
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Trefoil factor 3, TFI, TFF3, Polypeptide P1.B (hP1.B), ITF, Intestinal trefoil factor (hITF)

Chemical Properties

Molecular Weight

6.6 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.