Home Tools
Log in
Cart

SVSP Protein, Crotalus atrox, Recombinant (His)

Catalog No. TMPH-00450

SVSP Protein, Crotalus atrox, Recombinant (His) is expressed in Yeast.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
SVSP Protein, Crotalus atrox, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 397.00
100 μg 20 days $ 769.00
1 mg 20 days $ 2,760.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description SVSP Protein, Crotalus atrox, Recombinant (His) is expressed in Yeast.
Species Crotalus atrox
Expression System P. pastoris (Yeast)
Tag N-6xHis
Accession Number Q8QHK2
Amino Acid VVGGDECNINEHRSLVAIFNSTEFFCSGTLINQEWVVTAAHCDSTNFKMKLGVHSKKVPNEDEQTRNPKEKFFCPNKKKDDVLDKDIMLIKLDSPVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEKTLPDVPYCANIKLLDDAVCQPPYPELPATSRTLCAGIPEGGKDTCGGDSGGPLICNGQFQGIVFYGAHPCGQALKPGVYTKVFDYNDWIQSIIAGNTAATCPP
Construction 25-258 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 27.2 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Snake venom serine protease that may act in the hemostasis system of the prey.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol