SOD1 Protein, Mouse, Recombinant (E. coli, His)

Name: SOD1 Protein, Mouse, Recombinant (E. coli, His)
Brand: TargetMol
SKU: TMPH-02917
Rating: 4.5 (1 reviews)

(Synonyms: Superoxide dismutase [Cu-Zn], Sod1) Copy Product Info

Synonyms: Superoxide dismutase [Cu-Zn], Sod1

Catalog No. TMPH-02917 Copy Product Info

Destroys radicals which are normally produced within the cells and which are toxic to biological systems. SOD1 Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.8 kDa and the accession number is P08228.

SOD1 Protein, Mouse, Recombinant (E. coli, His)

Pack Size	Price	USA Stock	Global Stock
5 µg	$105	20 days	20 days
10 µg	$169	20 days	20 days
20 µg	$283	-	In Stock
50 µg	$428	20 days	20 days
100 µg	$590	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:93%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Destroys radicals which are normally produced within the cells and which are toxic to biological systems. SOD1 Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.8 kDa and the accession number is P08228.
Species	Mouse
Expression System	E. coli
Tag	N-6xHis
Accession Number	P08228
Amino Acid	AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Construction	2-154 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Superoxide dismutase [Cu-Zn], Sod1
Research Background	Destroys radicals which are normally produced within the cells and which are toxic to biological systems.

Chemical Properties

Molecular Weight

19.8 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.