SOD1 Protein, Canine, Recombinant (X53S, His)

Catalog No. TMPH-04741 Copy Product Info

SOD1 Protein, Canine, Recombinant (X53S, His) is expressed in E. coli. The accession number is Q8WNN6.

Catalog No. TMPH-04741

Copy Product Info

SOD1 Protein, Canine, Recombinant (X53S, His) is expressed in E. coli. The accession number is Q8WNN6.

Pack Size	Price	USA Stock	Global Stock
5 μg	$87	20 days	20 days
10 μg	$139	20 days	20 days
20 μg	$232	20 days	20 days
50 μg	$329	20 days	20 days
100 μg	$435	20 days	20 days
200 μg	$673	20 days	20 days
500 μg	$1,180	20 days	20 days
1 mg	$1,870	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	SOD1 Protein, Canine, Recombinant (X53S, His) is expressed in E. coli. The accession number is Q8WNN6.
Species	Canine
Expression System	E. coli
Tag	C-6xHis
Accession Number	Q8WNN6
Synonyms	Superoxide dismutase [Cu-Zn],SOD1
Amino Acid	MEMKAVCVLKGQGPVEGTIHFVQKGSGPVVVSGTITGLTEGEHGFHVHQFEDSTQGCTSAGPHFNPLSKKHGGPKDQERHVGDLGNVTAGKDGVAIVSIEDSLIALSGDYSIIGRTMVVHEKRDDLGKGDNEESTQTGNAGSRLACGVIGIAQ
Construction	1-153 aa (X53S)
Protein Purity	> 95% as determined by SDS-PAGE.
Molecular Weight	22.8 kDa (Predicted)
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 378 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

You can also refer to dose conversion for different animals. More

Please read the User Guide of Recombinant Proteins for more specific information.