Shopping Cart

Your shopping cart is currently empty

SDS Protein, Human, Recombinant (His & Myc)

Name: SDS Protein, Human, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-01617
Price: 89 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: SDS, SDH, L-threonine dehydratase (TDH), L-serine dehydratase/L-threonine deaminase, L-serine deaminase, Hepatic serine dehydratase (hSDH)) Copy Product Info

Synonyms: SDS, SDH, L-threonine dehydratase (TDH), L-serine dehydratase/L-threonine deaminase, L-serine deaminase, Hepatic serine dehydratase (hSDH)

Catalog No. TMPH-01617 Copy Product Info

Purity: 97%

SDS Protein, Human, Recombinant (His & Myc) is expressed in E. coli.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$89	-	In Stock
10 μg	$143	-	In Stock
20 μg	$237	-	In Stock
50 μg	$358	-	In Stock
100 μg	$490	20 days	20 days
200 μg	$755	20 days	20 days
500 μg	$1,330	20 days	20 days
1 mg	$2,080	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:97%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	SDS Protein, Human, Recombinant (His & Myc) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	P20132
Amino Acid	MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQLGMTNRLPK
Construction	1-328 aa
Protein Purity	> 90% as determined by SDS-PAGE. https://cdn.targetmol.com/group3/M00/3F/D6/CgoaEWh2NMaENMKxAAAAACooWpo111.jpg
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	SDS, SDH, L-threonine dehydratase (TDH), L-serine dehydratase/L-threonine deaminase, L-serine deaminase, Hepatic serine dehydratase (hSDH)
Research Background

Chemical Properties

Molecular Weight

42.1 kDa (predicted)

Storage & Solubility Information

Storage

Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

TDHhSDH

Related Tags: SDS Protein, Human, Recombinant (His & Myc) chemical structure | SDS Protein, Human, Recombinant (His & Myc) molecular weight