SCD1 Protein, Mouse, Recombinant (His & Myc)

Name: SCD1 Protein, Mouse, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-02491
Price: 105 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: Stearoyl-CoA desaturase 1, Scd1, Fatty acid desaturase 1, Delta(9)-desaturase 1 (Delta-9 desaturase 1), Acyl-CoA desaturase 1) Copy Product Info

Synonyms: Stearoyl-CoA desaturase 1, Scd1, Fatty acid desaturase 1, Delta(9)-desaturase 1 (Delta-9 desaturase 1), Acyl-CoA desaturase 1

Catalog No. TMPH-02491 Copy Product Info

Purity: 95%

SCD1 Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 18.4 kDa and the accession number is P13516.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$105	-	In Stock
10 µg	$169	-	In Stock
20 µg	$283	20 days	20 days
50 µg	$428	20 days	20 days
100 µg	$590	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:95%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	SCD1 Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 18.4 kDa and the accession number is P13516.
Species	Mouse
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	P13516
Amino Acid	VNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYHHTFPFDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKATVLARIKRTGDGSHKSS
Construction	260-355 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Stearoyl-CoA desaturase 1, Scd1, Fatty acid desaturase 1, Delta(9)-desaturase 1 (Delta-9 desaturase 1), Acyl-CoA desaturase 1
Research Background	Stearoyl-CoA desaturase that utilizes O(2) and electrons from reduced cytochrome b5 to introduce the first double bond into saturated fatty acyl-CoA substrates. Catalyzes the insertion of a cis double bond at the Delta-9 position into fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA. Gives rise to a mixture of 16:1 and 18:1 unsaturated fatty acids. Plays an important role in lipid biosynthesis. Plays an important role in regulating the expression of genes that are involved in lipogenesis and in regulating mitochondrial fatty acid oxidation. Plays an important role in body energy homeostasis. Contributes to the biosynthesis of membrane phospholipids, cholesterol esters and triglycerides. Required for normal development of sebaceous glands. Required for the biosynthesis of normal levels of Delta-9 unsaturated fatty acids and 1-alkyl-2,3-diacylglycerol in the Harderian gland. Required for normal production of meibum, an oily material that prevents drying of the cornea.

Chemical Properties

Molecular Weight

18.4 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.