Shopping Cart

Your shopping cart is currently empty

Ribonuclease mitogillin Protein, Neosartorya fumigata, Recombinant (His & Myc & SUMO)

Name: Ribonuclease mitogillin Protein, Neosartorya fumigata, Recombinant (His & Myc & SUMO)
Brand: TargetMol
SKU: TMPH-03055
Rating: 4.5 (1 reviews)

(Synonyms: Ribonuclease mitogillin, mitF, Major allergen Asp f 1, IgE-binding ribotoxin, aspF1, Allergen I/a, Allergen Asp f I) Copy Product Info

Synonyms: Ribonuclease mitogillin, mitF, Major allergen Asp f 1, IgE-binding ribotoxin, aspF1, Allergen I/a, Allergen Asp f I

Catalog No. TMPH-03055 Copy Product Info

This purine-specific ribonuclease cleaves 28S RNA in eukaryotic ribosomes, inhibits protein synthesis, and shows antitumor activity.

Ribonuclease mitogillin Protein, Neosartorya fumigata, Recombinant (His & Myc & SUMO)

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	-	In Stock
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:85% (SDS-PAGE)

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	This purine-specific ribonuclease cleaves 28S RNA in eukaryotic ribosomes, inhibits protein synthesis, and shows antitumor activity.
Species	Neosartorya fumigata
Expression System	E. coli
Tag	N-6xHis-SUMO, C-Myc
Accession Number	P67875
Amino Acid	ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Construction	28-176 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Ribonuclease mitogillin, mitF, Major allergen Asp f 1, IgE-binding ribotoxin, aspF1, Allergen I/a, Allergen Asp f I
Research Background	This purine-specific ribonuclease cleaves 28S RNA in eukaryotic ribosomes, inhibits protein synthesis, and shows antitumor activity.

Chemical Properties

Molecular Weight

31.2 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

aspF 1Allergen Asp fI

Related Tags: Ribonuclease mitogillin Protein, Neosartorya fumigata, Recombinant (His & Myc & SUMO) chemical structure | Ribonuclease mitogillin Protein, Neosartorya fumigata, Recombinant (His & Myc & SUMO) molecular weight