RAC1 Protein, Human, Recombinant (His)

Name: RAC1 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-00004
Rating: 4.5 (1 reviews)

(Synonyms: TC25, Ras-related C3 botulinum toxin substrate 1, Ras-like protein TC25, RAC1, p21-Rac1, Cell migration-inducing gene 5 protein) Copy Product Info

Synonyms: TC25, Ras-related C3 botulinum toxin substrate 1, Ras-like protein TC25, RAC1, p21-Rac1, Cell migration-inducing gene 5 protein

Catalog No. TMPH-00004 Copy Product Info

RAC1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 24.6 kDa; 30 kDa, reducing conditions and the accession number is P63000.

Pack Size	Price	USA Stock	Global Stock
5 µg	$349	20 days	20 days
10 µg	$589	20 days	20 days
20 µg	$995	-	In Stock

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:85%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	RAC1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 24.6 kDa; 30 kDa, reducing conditions and the accession number is P63000.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	C-6xHis
Accession Number	P63000
Amino Acid	MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKC
Construction	1-189 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Synonyms	TC25, Ras-related C3 botulinum toxin substrate 1, Ras-like protein TC25, RAC1, p21-Rac1, Cell migration-inducing gene 5 protein

Chemical Properties

Molecular Weight

24.6 kDa (predicted); 30 kDa (reducing conditions)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.