Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: TC25, Ras-related C3 botulinum toxin substrate 1, Ras-like protein TC25, RAC1, p21-Rac1, Cell migration-inducing gene 5 protein

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $349 | 20 days | 20 days | |
| 10 μg | $589 | 20 days | 20 days | |
| 20 μg | $995 | - | In Stock |
| Description | RAC1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 24.6 kDa; 30 kDa, reducing conditions and the accession number is P63000. |
| Species | Human |
| Expression System | P. pastoris (Yeast) |
| Tag | C-6xHis |
| Accession Number | P63000 |
| Amino Acid | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKC |
| Construction | 1-189 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. https://cdn.targetmol.com/group3/M00/13/CC/CgoaEWZQd3OEDRjvAAAAAJOMWT4186.png |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | TC25, Ras-related C3 botulinum toxin substrate 1, Ras-like protein TC25, RAC1, p21-Rac1, Cell migration-inducing gene 5 protein |
| Molecular Weight | 24.6 kDa (predicted); 30 kDa (reducing conditions) |
| Storage | Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.